Információ

Vannak olyan online források, amelyek felsorolják a fordítás utáni módosításokat és azok molekulatömegét?


Egy fehérjét tanulmányozok, és kíváncsi vagyok az összes poszt-transzlációs módosítására, amellyel rendelkezik (a Western blot módszerrel elemezve). Találtam egy listát a benne lévő poszt-transzlációs módosításokról, de szeretném tudni, hogy mekkora a poszt-transzlációs módosítások molekulatömege (dalton/kilodalton). Megtaláltam ezt az oldalt, de nem tudom, mi a különbség a „Monoizotóp tömegváltozás” és az „Átlagos tömegváltozás” között, és hogy az értékek milyen mértékegységekben vannak.

Arra voltam kíváncsi, hogy vannak-e megbízható online források, amelyek felsorolják az összes létező poszt-transzlációs módosítást és a hozzájuk tartozó molekulatömeget? Bármilyen felismerést nagyra értékelünk.


Talált egyet. Mivel a Sigma-Aldrich link "Monoizotóp" és "Átlagos" oszlopai közötti különbségek rendkívül alacsonyak, funkcionálisan azt mondhatjuk, hogy közel azonosak. A tömegek atomtömegegységekben vagy daltonokban vannak megadva.

Ezek a számok azonban az LC/MS/MS által elemzett módosított peptidekben tapasztalt tényleges tömegváltozásokból származnak, jellemzően az emésztett fehérjékből. A tömegspecifikáció nagyon pontos platform, amint azt a táblázatban szereplő számok tizedesjegyeiből is láthatja. A fehérjeméret Western-blot módszerrel történő becslésekor a hibahatár kisebb (10-50 kDa) fehérjék esetében legalább 1 kilodalton, nagyobb fehérjék esetében pedig 5-10 kDa vagy több. Mivel egyetlen foszforilációs esemény csak 0,08 kDa-val változtatná meg a célfehérje tömegét, ennek meghatározása Western-blottal lényegében lehetetlen. A bizonyítékok azonban azt mutatják, hogy az egyetlen foszforilációs esemény által módosított fehérjék általában (néha sok) más poszttranszlációs módosításokkal (PTM) is rendelkeznek, beleértve más foszfohelyeket, metilezést, acetilezést, glikozilációt stb., amelyek láthatóan befolyásolhatják a módosított fehérje mobilitása SDS-PAGE gélben.

Egy másik tényező, amelyre gondolni kell, az, hogy az SDS-PAGE gélek denaturálásakor (amelyekből a legtöbb Western blot keletkezik) a migrációs sebességet nem csak a teljes molekulatömeg, hanem a töltés is befolyásolja, mivel a fehérjék elektromos mezőben vándorolnak. Amikor ezeket a fehérjéket SDS, egy töltött detergens linearizálja, teljes töltésük nagyjából arányos méretükkel. Azonban a feltöltött PTM-ek, például a foszforiláció, befolyásolják ezt a teljes töltést, és módosíthatják a migrációs sebességet a töltésnek megfelelően. továbbá extra tömegükhöz.

Kombinálja mindezt, és PTM-módosított fehérjék némileg eltérő ütemben vándorolnak, mint az csak a módosítás (ok) fizikai tömege alapján várható. Amikor elkezdi kombinálni több PTM -et, különösen a különböző PTM -eket (például foszforilezés és acetilezés), nagyon nehéz vagy lehetetlenné válik a várható látszólagos molekulatömeg előrejelzése.


Absztrakt

A fehérje poszttranszlációs módosításai (PTM) olyan kulcsfontosságú bakteriális jellemzők, amelyek képesek módosítani a fehérje működését és a környezeti jelzésekre adott válaszokat. Egészen a közelmúltig a prokarióta rendszerek szabályozásában betöltött szerepüket nagyrészt elhanyagolták. A tömegspektrometrián alapuló proteomika legújabb fejleményei azonban páratlan azonosítást és számszerűsítést tesznek lehetővé azokban a fehérjékben és peptidekben, amelyek PTM-eken esnek át a baktériumokban, beleértve azokat a fajokat is, amelyek közvetlenül vagy közvetve befolyásolják az emberi egészséget. Itt ezzel a kérdéssel foglalkozunk a PTM peptidek és a baktériumfajokból származó fehérjék eddigi legnagyobb és legátfogóbb összegyűjtésével és összehasonlításával. Az adatokat 91 vizsgálatból gyűjtöttük, amelyek PTM bakteriális peptidekre vagy tömegspektrometriás módszerekkel azonosított fehérjékre vonatkoztak. A jelen elemzés feltárta, hogy jelentős átfedés volt a PTM-ek között a fajok között, különösen az acetilezés és más PTM-ek, különösen a szukciniláció között. A filogenetikailag közelebbi fajok több egymást átfedő foszfoproteómot tartalmazhatnak, de a környezeti tényezők is hozzájárulnak ehhez a közelséghez. A baktériumok közötti PTM-eket rendkívül sokoldalúnak és változatosnak találták, ami azt jelenti, hogy ugyanaz a fehérje sokféle módosításon eshet át több fajon belül, de ugyanazon a fajon belül is különböző módosulásokat szenvedhet el.


Vannak olyan online források, amelyek felsorolják a fordítás utáni módosításokat és azok molekulatömegét? - Biológia

Fehérje poszt-transzlációs módosítások a gerincvelő sérülése után

Shuang Zhu 1, Bing-Sheng Yang 1, Si-Jing Li 1, Ge Tong 2, Jian-Ye Tan 1, Guo-Feng Wu 1, Lin Li 1, Guo-Li Chen MD, PhD 3, Qian Chen PhD 4, Li-Jun Lin MD, PhD 1
1 Ízületi és Ortopédiai Osztály, Zhujiang Hospital, Southern Medical University, Guangzhou, Guangdong tartomány, Kína
2 Orvosi ultrahangos tanszék, Guangdong tartomány Hepatológiai Kutatólaboratórium, A Sun Yat-sen Egyetem harmadik kapcsolt kórháza, Guangzhou, Guangdong tartomány, Kína
3 Ortopédiai Osztály, Putian Egyetem társult kórháza, Putian, Fujian tartomány, Kína
4 Sejt- és molekuláris biológiai laboratórium, Ortopédia Tanszék, Brown Egyetem Alpert Medical School/Rhode Island Hospital, Providence, RI, USA

Beküldés dátuma2020. augusztus 05
Határozat kelte2020. szeptember 11
Elfogadás dátuma2020. november 22
Webes megjelenés dátuma2021. február 19

Levelezési cím:
Guo-Li Chen
Ortopédia Tanszék, Putian Egyetem Kórháza, Putian, Fujian tartomány
Kína
Li-Jun Lin
Ízületi és Ortopédiai Osztály, Zhujiang Hospital, Southern Medical University, Guangzhou, Guangdong tartomány
Kína
Qian Chen
Sejt- és molekuláris biológiai laboratórium, Ortopédia Tanszék, Brown Egyetem Alpert Medical School/Rhode Island Hospital, Providence, RI
USA

Támogatás forrása: Ezt a munkát a Kínai Nemzeti Természettudományi Alapítvány támogatta, 81801210 (SZ), Összeférhetetlenség: Egyik sem

DOI: 10.4103/1673-5374.308068

A gerincvelő belső neuronális kapacitásainak hiánya, a növekedéstámogatás hiánya és az axonális kinövés gátló molekulák általi elnyomása azt jelenti, hogy a gerincvelő sérülése szinte mindig pusztító következményekkel jár. Mint ilyen, a gerincvelő-sérülés kezelésének egyik elsődleges célja, hogy stratégiákat dolgozzon ki a külső vagy belső axonális növekedést gátló tényezők antagonizálására vagy az axonális növekedést támogató tényezők fokozására. Ezen tényezők közül számos egyedi fehérje szint rendellenességet azonosítottak a gerincvelő sérülését követő axonok generálása során. Ezen túlmenően, egyre több tanulmány jelezte, hogy ezeknek a fehérjéknek a poszttranszlációs módosulásai fontos hatással vannak az axonnövekedésre. Egyes kutatók a gerincvelő sérülése után számos poszt-transzlációs módosítást fedeztek fel, például tirozinációt, acetilezést és foszforilációt. Ebben a felülvizsgálatban áttekintettük az axonális növekedés, a funkcionális helyreállítás és a gerincvelő sérülése utáni neuropátiás fájdalom utáni transzláció utáni módosításait, amelyek jobb megértése tisztázhatja a gerincvelő-sérüléssel kapcsolatos molekulák dinamikus változását és elősegítheti egy új terápiás stratégia a gerincvelő sérülésére.

Kulcsszavak: extracelluláris mátrix funkció károsodás glia heg ideg regeneráció neuropátiás fájdalom poszttranszlációs módosulás gerincvelő sérülés terápiás cél


Hogyan kell idézni ezt a cikket:
Zhu S, Yang BS, Li SJ, Tong G, Tan JY, Wu GF, Li L, Chen GL, Chen Q, Lin LJ. Fehérje poszt-transzlációs módosítások a gerincvelő sérülése után. Neural Regen Res 202116: 1935-43

Hogyan kell idézni ezt az URL-t:
Zhu S, Yang BS, Li SJ, Tong G, Tan JY, Wu GF, Li L, Chen GL, Chen Q, Lin LJ. Fehérje poszt-transzlációs módosítások a gerincvelő sérülése után. Neural Regen Res [online sorozat] 2021 [idézve: 2021. június 20.]16:1935-43. Elérhető: http://www.nrronline.org/text.asp?2021/16/10/1935/308068

Shuang Zhu, Bing-Sheng Yang. Ezek a szerzők egyformán hozzájárultak ehhez a munkához.

Általában az SCI három fázisra osztható (Tator et al., 2009). Az akut fázis, amelyet a gerincvelői szövetek közvetlen becsapódás vagy lökéshullámok okoznak, számos párhuzamos patofiziológiai folyamatot indít el. Az idegi és vaszkuláris szövetek mechanikai megsértése nekrózishoz és sejthalálhoz, a K+, Na+, Ca 2+ ionos egyensúlyhiánya pedig idegi működési zavarokhoz és gerincsokkhoz vezethet (Baumann, 2020). Továbbá a levágott axonok Waller -féle degeneráción esnek át. További részletek az axon disztális részéről, valamint a hozzájuk tartozó mielinhüvelyek. Az SCI másodlagos stádiuma (szubakut sérülési fázis) a sérülés után néhány perctől néhány hétig bármi előfordulhat, amely során az idegrendszer súlyosabban károsodik (Lin, 2020). Ennek a szakasznak a kórélettana több folyamatot is magában foglal, például apoptózist és szabad gyökök képződését. A citokinkoncentráció növekedése és a limfociták folyamatos beszivárgása, amely a sejthalált követően következik be, gyorsan növeli a sejthalált. Az SCI krónikus fázissá alakulhat a sérülést követő néhány naptól vagy néhány évtől kezdve, amikor a test szürkeállománya fokozatosan feloldódik, a kötőszövet fokozatosan lerakódik, és gliás hegek képződnek (Liu et al., 2019) . Ezenkívül sok sejtben az állandó túlzott izgatottság krónikus neuropátiás fájdalmat okoz a legtöbb betegben (Bahari és mtsai, 2019 Calvo és mtsai, 2019).

E fázisok mindegyikében számos folyamat megy végbe a transzkripció, az RNS-szerkesztés, a transzláció és a poszt-transzlációs módosítás (PTM) szintjén (Mierke, 2020). Ezek közül különösen a PTM keltett érdeklődést az elmúlt évtizedekben, mert visszafordíthatóan manipulálható a transzkripció, az RNS -szerkesztés és a fordítás visszafordíthatatlan folyamatához képest. A poszttranszlációs módosítás a polipeptid láncok kémiai modulálásának folyamata transzkripciót és transzlációt követően. A sejtekben a PTM játssza a fő szabályozó szerepet a fehérjék konformációs változásában. A PTM részvételével a test fehérjéi megváltoztatják konformációjukat, ami viszont befolyásolja a különböző fehérjékkel való kölcsönhatásukat, és befolyásolja a downstream jelátvitelt (Czuba et al., 2018). Ezenkívül a PTM-ek által bevezetett fehérjék számos funkcionális változása azonnali és visszafordítható. A funkcionális változások hasonló szabályozása de novo szintézissel vagy fehérje lebontással idő- és bioenergia-igényesebb lenne, mint a PTM-ek (Uversky, 2013). Ebben az értelemben a PTM -ek célzása pontosabb és gazdaságosabb, mint a géntranszkripció és transzláció. Az SCI gyorsan változó patológiás folyamatához képest az SCI utáni génexpressziós változások lassúak. Míg a fehérjéken vagy aminosavakon lévő PTM-ek azonnal megváltoztathatják a fehérjék működését, így a PTM ideális célpont az SCI drámaian változó fázisainak lassítására vagy megállítására. Beszámoltak arról, hogy a PTM részt vesz az SCI számos patofiziológiai folyamatában, például az axonregenerációban (Voulalas és mtsai, 2017 Qi és mtsai, 2019), a gliális hegek képződésében (Gliem és mtsai, 2015 Wang és mtsai, 2016) ), a gátló molekulatermelés (Wong és mtsai, 2018), a maladaptív plaszticitás (Imagama és mtsai, 2011) és a neuropátiás fájdalom megjelenése (Lai et al., 2016). A PTM elemezhető és először módosított típusokba sorolható, aminosavmódosítások, például proteolízis, amely szintén deamidálható, hogy lehetővé tegye a fehérje lehasadását, másodszor, komplex molekulák módosítása olyan folyamatok révén, mint a glikozilezés és az acilezés, ami lehetővé teszi a fehérjék molekuláris szerkezetét harmadikként a kémiai módosításokat, például oxidációt és metilezést, negyedszer pedig a polipeptid módosításokat, mint például az ubiquitinációt és a szulfonilációt (Audagnotto et al., 2017 Spoel, 2018). A PTM hatással van a sejtek fiziológiai folyamataira a szervezet normál élettani tevékenységei és abnormális élettani tevékenységei során egyaránt, és módosíthatja a fehérjék működését a fehérjék lebontásával, a fehérjék közötti kölcsönhatás befolyásolásával és a fehérjék szerkezetének megváltoztatásával (Beltrao et al., 2013). L üscher et al., 2018 Gao et al., 2020). Számos PTM-et dokumentáltak az SCI összefüggésében, beleértve az acetilezést (Hubbert et al., 2002 Reed és mtsai, 2006), a nitrozilációt (Scheving és mtsai, 2012 Khan és mtsai, 2019), a foszforilációt (Xu et al. , 2006 Voulalas és mtsai, 2017), ribozilátok (Kuzhandaivel et al., 2010), ubikvitináció (Lai és mtsai, 2016 Jeong és mtsai, 2018), valamint az oxidáció (Ingles és mtsai, 2016). Azonban még mindig nem világos, hogy ezek a módosítások hogyan járulnak hozzá az SCI patofiziológiai folyamatához, vagy hogy a szerepmódosítás mekkora szerepet játszik az egyes patofiziológiai folyamatokban vagy specifikus funkcionális károsodásokban. A gerincvelő regenerációját elsősorban a csökkent belső idegi kapacitások és a külső gátló környezet akadályozza. Itt áttekintettük a jelentett PTM-eket az SCI helyreállítását befolyásoló belső és külső tényezőkről. Eredményeink azt mutatják, hogy a PTM az SCI fontos terápiás célpontja, mivel sokkal szabályozhatóbb és visszafordíthatóbb, mint a hagyományos terápiás stratégiák. Ezenkívül a neuropátiás fájdalomcsillapításban betöltött szerepe ígéretes a jövőbeli klinikai munka számára, és a jövőbeni munkák során tanulmányozni kell.

PubMed keresést végeztünk SCI/SCI/idegsejtek állatmodellekkel rendelkező betegek, neurogenezis/neuroregeneráció/axonális regeneráció és azok eredményei között. Az SCI után 1992 és 2020 között publikált tanulmányok a PTM -en a PubMed adatbázisban kerültek azonosításra. Az SCI utáni specifikus PTM-ekre vonatkozó részletesebb információkat az “SCI” kifejezés és a kívánt kifejezés (pl. “phosphorylation”) kombinációjával kerestük. Az acetiláció részletesebb feltárása érdekében az “acetiláció ” kifejezést a “SCI ” kifejezéssel is kombinálták. A neurogenezisről, a neuroregenerációról és az axonális regenerációról szóló publikációkat e két kifejezés és a “SCI ” kifejezés kombinálásával szereztük be. Az azonosított kiadványok relevanciáját a címben, az absztraktban és a kulcsszavakban található keresési kifejezések ellenőrzésével ellenőrizték. A nem SCI kísérleteket kizártuk. Lehetőség szerint az általános, nem pedig a friss eredményekre összpontosítottunk.

Mikrotubulusok poszttranszlációs módosításai

Atashi et al. (1992) kimutatták, hogy a tubulin foszforilációjának mértéke a növekedési kúp által tapasztalt helyi tapadási jelekre adott válaszként befolyásolhatja a mikrotubulusok polimerizációját az idegek regenerációjának szabályozása érdekében. A szerzők azt találták, hogy a sejtadhéziós molekulák és a sejtadhéziós molekulák elleni antitestek gátolják a tubulin foszforilációját a növekedési kúp membránjaiban. Az idegsejtekben és a gliasejtekben expresszálódó 1B mikrotubulus-asszociált fehérje (MAP1B) egy fő növekedéssel összefüggő és citoszkeletális fehérje. Kapcsolódó tanulmányok arról számoltak be, hogy amikor a MAP1B működik, akkor azt befolyásolhatja a MAP1B foszforilációja. A PC12 (patkány mellékvesevelő feokromocitómájából származó sejtvonal) sejtaxonnövekedés vizsgálata során a kutatók sikeresen felfedezték ezt a jelenséget, hogy a MAP1B foszforilációja hozzájárul a MAP1B funkcionális változásaihoz NGF-indukció alkalmazásakor (Migita et al., 2019). Nagy mennyiségű MAP1B található a növekvő axonokban, és a foszforilezés után a MAP1B elősegíti a növekedési kúpok növekedését (Ramkumar et al., 2018 Igarashi, 2019)

A MAP1B foszforilezése azonban nem feltétlenül segíti elő az idegsejtek növekedését (Igarashi et al., 2020). Egyes kutatók arról számoltak be, hogy miután a patkányokat alginsav megsebesítette, az afferens szálak megfoszthatók az alginsavkezeléstől, ami hatékonyan elősegíti a MAP1B expresszióját és fokozza annak foszforilációját (Soares et al., 1998). Továbbá, agyrázkódás után a patkányokról kimutatták, hogy újra expresszálják a MAP1B-t, és azt is foszforilezik. Ezért úgy tűnik, hogy ezen fehérjék jelenléte lehetővé teszi az idegsejtek regenerálódását (Emery és mtsai, 2000).

A tubulin -acetilezésről kiderült, hogy számos élettani funkcióban szerepet játszik, nemcsak elősegíti az axon kinövését, hanem szerepet játszik az axon elágazásában is (Rossaert et al., 2020). A tubulin-deacetiláz, a hiszton-dezacetiláz 6 (HDAC6) és a sirtuin 2 (SIRT2) befolyásolják a tubulin acetilációs állapotát. Egyes tanulmányok kimutatták, hogy a Lys40-nél a α-tubulin acetilezése megkönnyíti az axonális transzportot, mivel elősegíti a kinesin és a dynein motoros fehérjék mikrotubulusokhoz való kötődését (Mo és mtsai., 2018 Rossaert és mtsai, 2020). A HDAC6 -ról is kimutatták, hogy deacetilálja a tubulint (Hubbert és mtsai, 2002). Ezenkívül a α-tubulin-acetilációt fokozhatja a HDAC6 gátlás, amely elősegíti az axonális transzportot, és hasznosnak bizonyult a neurodegeneratív betegségek, például a Huntington-féle betegség állatmodelljeiben (Guo és mtsai, 2017). Az SCI egérmodelljét használva Dan és mtsai. (2018) kimutatták, hogy a MEC-17 ablációjával a α-tubulin acetiláció gátolható, ami viszont a neuronális axonok túlszaporodásához vezet. Ez a mikrotubulusok lecsévélését okozza, amelyek ezután behatolnak a filopódiákba. Egy másik SCI egérmodell vizsgálatban Zheng és mtsai. (2020) azt találták, hogy a HDAC6 szintje a szervezetben jelentősen megnőtt az SCI után, míg a HDAC6 Tubastatin A gátlása funkcionális helyreállítást indukált a kontúzív SCI egérmodellben. Ennek feltehetően az az oka, hogy a HDAC6 gátlása előidézheti a mikrotubulusok acetilezését és stabilizálódását, ezáltal helyreállíthatja a transzport funkciót, ami megnövelheti az axonhosszt és helyreállíthatja az autofág fluxust. A kapcsolódó jelentések szerint az Elp3 elősegítheti az acetilációt és gátolhatja a HDAC6 szabályozását, az Elp3 sejtek elnémítása pedig késleltetheti a migrációt és károsíthatja az idegsejteket (Creppe et al., 2009).

Korábbi kutatások egyértelműen kimutatták, hogy az axonnövekedés befolyásolja az SCI előfordulását, és hogy szoros kapcsolat van e folyamat és a mikrotubulus-függő retrográd transzport között (Mo és mtsai, 2018 Guo és mtsai, 2020 Rossaert és mtsai, 2020). A mikrotubulusok felépítésének elemzésekor a szerzők megállapították, hogy a β-tubulin és a α-terminális C-terminálja látható. Ez az oldal is a MAP -ok magja. A mikrotubulusok detirozinációja, glutamilációja és glikozilációja szintén segíthet a MAP-ok és a molekulamotorok kölcsönhatásának és aktivitásának szabályozásában (Janke et al., 2011).Amikor az axonok megsérülnek, a tubulin tirozin ligáz (TTL) a sérült helyen növeli a α-tubulin tirozin szintjét, ami elősegítheti a sérülési jelek retrográd transzportját (Song et al., 2015). Egyes kutatók bebizonyították, hogy vad típusú állatokban a mikrotubulusok detirozinációja gátolható szeszkviterpén-lakton-kúszólakton használatával. Ha az egész testet vagy testrészt hidrokinon -laktonnal kezelik, akkor elősegíthető az axonok regenerációja és a funkcionális helyreállítás. Ezért feltételezhető, hogy a mikrotubulusok detirozinációjának gátlása javíthatja a kezelés hatását idegsérült betegek kezelésekor (Gobrecht et al., 2019).

Tanulmányok kimutatták, hogy ha az axonokat stabil állapotban lehet tartani, akkor a mikrotubulusok poliglutamilezési szintje magas, míg a szervezet alacsony poliglutamináz aktivitással rendelkezik (Audebert et al., 1993). Ikegami és mtsai. (2006) megállapították, hogy a tubulin tirozin ligáz-szerű (TTLL) fehérje elősegíti a poliglutamilációt, amely az idegrendszer legmagasabb szintjén írható át. Ezenkívül a túlzott mikrotubulus-glutamiláció közvetlenül kapcsolódik a neurodegenerációhoz, és a fő agyi poliglutamát-amiláz TTLL1 csökkent szabályozása részben megakadályozza a Purkinje-sejtek degenerációját a PCD egerek kisagyában (Rogowski et al., 2010). Egyes kutatások kimutatták, hogy egyfajta β-tubulin-poliglutaminázként szoros kapcsolat van a TTLL7 és a MAP2-pozitív neuritok között meridiánszerű (PC12) sejtekben (Ikegami et al., 2006 Sferra et al., 2020). ). Mi több, Maas és mtsai. (2009) azt találták, hogy a poliglutamiláció befolyásolja a neuronok aktivitását patkányokban a szinaptikus vezikulák transzportjának szabályozásával.

Stimuláló útvonal transzláció utáni módosítások

Az extracelluláris szignál-szabályozott kináz (ERK) különféle neurotróf faktorokra reagálva aktiválódik (Hausott et al., 2019 Jin et al., 2020). Az ERK elősegíti a növekedési kúp mozgékonyságát és a regenerációt axonális sérülés után felnőtt hátsó gyökér ganglion axonokban (Manire, 2019 Liu et al., 2020). Xu et al. (2006) kimutatták, hogy a nitrálás modulálni tudja a 3-nitrotirozint SCI után. Amikor az SCI akut fázisban van, a nitrogén-monoxid támadás fokozása nemcsak az ERK1/2 foszforilációs szintjét növeli, hanem a p38 mitogén által aktivált protein kináz szintjét is. És ezek a fehérjék fontos szerepet játszanak az akut SCI-t követő neuronális degenerációban. Sőt, a K + /Cl – cotransporter 2 (KCC2) aktiváció hasznosnak bizonyult a neuropátiás fájdalomcsillapításban és a gerincvelő -sérülések helyreállításában (Cardarelli et al., 2017 Chen et al., 2018). A KCC2 konstitutív membrán-újrahasznosítását a C-terminális 940-es szerinmaradék (S940) foszforilációs állapota szabályozza. Az S940 fehérje kináz C (PKC) általi foszforilációja a KCC2-ben korlátozza a KCC2 hasítását lizoszómákban klatrinfüggő endocitózist követően, és csökkenti a plazmamembránból származó KCC2 internalizáció sebességét (Lee et al., 2007). A KCC2 expressziója pedig a BDNF-TrkB útvonal PLC ⓿ és Shc jelátviteli kaszkádjainak aktiválását követően alulszabályozott, ami nyilvánvaló azon a peri-lesion helyen, ahol a BDNF felhalmozódik az SCI után (Carter et al., 2018). Továbbá a BDNF aktiválja a neuronális m-Calpain-t, egy proteázt, amely a KCC2 visszafordíthatatlan inaktiválását eredményezi a MAPK által közvetített foszforiláció révén (Puskarjov és mtsai, 2012). Ezenkívül az NMDA receptorok aktiválása növeli az intracelluláris Ca 2+ koncentrációt, és a KCC2 a citoszolba kerül az S940 defoszforilációjához a protein foszfatáz 1 (PP1) által, ezáltal csökken a funkcionális KCC2 szint a plazmamembránban (Lee et al., 2011). .

Gátlási útvonal poszttranszlációs módosításai

Egyes kutatók azt javasolták, hogy az SCI után az Rho jelátviteli út expressziós szintje megnő (Hong et al., 2019 Xiao et al., 2019). A Rho és a downstream effektor ROCK kináz aktiválása növekedési kúp összeomlást vált ki, és fontos akadályt jelent az axonok regenerációjában (Koch et al., 2018). Beszámoltak arról, hogy a Rho és a ROCK gátló hatása miatt a kondroitin-szulfát proteoglikán (CSPG) nem tudja gátolni a neuritok növekedését (Monnier és mtsai, 2003). A kondroitin -szulfát pedig a#8194ROCK és a#8194 aktiválás révén rontja az idegi őssejtek migrációját (Galindo és mtsai, 2018). Ezenkívül a jelentések szerint az idegi axonok irányítását és kiterjesztését befolyásolja a Rho család guanin-nukleotid-trifoszfatáza (GTPázok) (Galino et al., 2019). Az Rho GTPázok fordítása és módosítása befolyásolhatja az Rho GTPázok aktivitását (Denk-Lobnig et al., 2019). A preniláció előfordulhat a fehérjék C-terminálisán, és a preniláció jelenléte segít irányítani a neuritok kinövését (Jennings et al., 2018 Reddy et al., 2020). Ezenkívül a Collapsin válaszközvetítő fehérje 2 (CRMP2) jelzés koordinálja a citoszkeletális képződést és szabályozza a sejtosztódást, a migrációt, a polaritást és a szinaptikus kapcsolatot. A CRMP2 foszforiláció gátlása elősegíti a motoros és érzékszervi axonok axonális regenerálódását és/vagy csírázását, stabilizálja az asztrocitákban található mikrotubulusokat, hogy gátolja a rostos hegek képződését az SCI után, és csökkenti a gyulladásos sejtek beszivárgását (Nagai et al., 2016).

Az SCI krónikus szakaszában a szervezetben számos fiziológiai változás következik be, mint például a gliasejtek burjánzása, a kötőszövet lerakódása és a szürkeállomány feloldódása, amelyek glia hegek kialakulását okozzák a gerincvelőn (Bradbury és munkatársai, 2019). Az extracelluláris mátrixmolekulák és a reaktív asztrociták a fő anyagok, amelyek gliális hegeket képeznek (He et al., 2020). Az SCI után nagyszámú asztrocita kötődik a hegterülethez, ezen asztrociták jelenléte a szövet mechanikai szilárdságának növekedését okozza, ami megnehezíti a sejtmigrációt és az axonnövekedést a szöveten keresztül. Ezenkívül a heg ragadós alapmembránjához kötődő axonnövekedést gátló molekulák nagy lokális koncentrációban halmozódnak fel a lézió helyén (Tran és mtsai, 2018).

Egy tanulmányban Besson és mtsai. (2004) kimutatták, hogy a p27kip1 ciklinfüggő kináz inhibitor gátolja az asztrociták fiziológiai aktivitását, és szerepet játszik a sejtek migrációjában és proliferációjában. Egy korábbi tanulmány kimutatta, hogy a p27Kip1 O-GlcNAcilációjának gátlása Ser2-n egy génmutációval (S2A) gyengítette a Ser10 foszforilációját az asztrocitákban, ami elősegítette az asztrociták mozgékonyságát és csökkentette a hegképződést gerincvelő-zúzódásban szenvedő patkányokban (Mao et al., 2015). Az SCI patkánymodelljében Zhao és mtsai. (2011) azt találták, hogy a sejtciklus G1 fázisában az ubiquitin ligáz KPC lebonthatja a p27kip1 -et. A KPC katalitikus alegységeként szoros kapcsolat van a KPC1 és a patkány asztrocita -proliferáció között (Zhao és mtsai, 2011).

A glikozilezés egy transzlációs módosítási folyamat, amely nemcsak a szubcelluláris lokalizációt, hanem a fehérjék szerkezetét is befolyásolja. A C/EBP δ-függő transzkripcióhoz szükséges szulfonilezést gátoltnak találták lipogén induktorok és epidermális növekedési faktor beadása után (Lai et al., 2008). Ezenkívül a C/EBP δ bizonyítottan hozzájárul a gliális hegek kialakulásához, ezáltal rontja a funkcionális helyreállást patkányok és a kontúziós SCI után (Wang és mtsai, 2016).

A hegesedésen kívül a gátló molekulák az SCI utáni gátló környezet fő elemei. Valójában a gliális heg természetes tartályként működik a gátló molekulák számára, ami növeli a gátló molekulák koncentrációját és súlyosbítja a gátló hatást. A myelin-asszociált molekulák a legtöbbet vizsgált inhibitorcsoport, ezek egyike a Nogo-A, amely a neuronmembrán receptoraihoz kötődik, gátolja a növekedést, és egyben a növekedési kúpok összeomlását okozza (Zhao et al., 2019). ). A Nogo-A ablációja elősegíti a LIMK1 foszforilációját, amely tovább aktiválja a cofilint azáltal, hogy csökkenti foszforilációját. Állítólag az aktin dinamikáját is szabályozza a Cofilin, amely megszakíthatja a filamentumok aktivitását, ezáltal szabályozva a motoros fehérjék erejét (Montani et al., 2009). Ez arra utal, hogy szoros kapcsolat van a Nogo-A neuron és a növekedési kúp mozgékonysága között. Ami a Nogo-A módosítását illeti, Yokoyama et al. (2006) azt találták, hogy a Nogo-A-t Src-család kinázai foszforilálták a Tyr-694-nél, ami azt jelzi, hogy a Nogo-A funkciók további komplexitással rendelkeznek.

A mikrotubulus α-tubulin acetilációja elősegíthető a hiszton-dezacetiláz-6 (HDAC6) gátlásával, miközben egyidejűleg helyreállítja a CSPG-k és MAG-gátolt axonok növekedését (Rivieccio et al., 2009), ezzel szemben a tubulin-acetil-transzferáz-1 (1) A αTAT1 acetilezés) ellenkező funkciót tölt be (Cueva et al., 2012). Olyan kutatók, mint Wong et al. (2018) az SCI egérmodelljét használták annak kimutatására, hogy a αTAT1 leszabályozott a MAG és a CSPG hatására, míg a HDAC6 szintek vagy a HDAC6 aktivitás változatlan marad a CSPG-nek és a MAG-nak való kitettség mellett. Ezenkívül az alulszabályozott αTAT1 túlzott expressziója helyreállíthatja a neuritok növekedését, ami azt jelezheti, hogy a célzás és a#945TAT1 poszt-transzlációs szinten terápiás potenciállal bírhat az SCI után.

A CSPG-k a proteoglikánok osztályába tartoznak (Listik et al., 2019), amelyek nemcsak gátlóként működnek, hanem útkeresőként és axonkinövés útmutatóként is szolgálnak az SCI után (Schmidt, 2019). Korábbi tanulmányok azt találták, hogy a CSPG CS-lánca, KS-lánca és N-glikán-lánca gátolja a neuritok növekedését. Mindazonáltal ezeknek az összetevőknek a hozzájárulását még nem vizsgálták transzláció utáni módosítási stratégia alkalmazásával, egy tanulmány szerzői a három komponenst specifikus enzimekkel emésztették, és a CS és az N-glikánok gátolták az NS neurit kinövését -1 sejt (Hering és mtsai, 2020). Ez azt jelzi, hogy a CSPG PTM -je neurit kinövéskor terápiás célpont lehet az SCI számára.

Mátrix metalloproteinázok

A mátrix metalloproteinázok (MMP) nemcsak a sejtek közötti kölcsönhatásban vesznek részt, hanem a sejtek és az extracelluláris mátrix közötti kölcsönhatásban is. Az MMP-k beavatkoznak a proteolitikus folyamatba, ami elengedhetetlen a normál fejlődéshez, a sebgyógyuláshoz és az élethosszig tartó helyreállító mátrix-átalakításhoz (Sanderson et al., 2019). Az SCI-ben az MMP-kről kimutatták, hogy hozzájárulnak a progresszív neuroinflammatorikus válaszhoz, az oxidatív stresszhez, az apoptózishoz és a gliaheg lebomlásához (Zhang és mtsai, 2011). Az SCI utáni szövődmények előfordulása számos tényezőtől függ, beleértve azt is, hogy mikor és hol fejeződnek ki az MMP-k, valamint a rendelkezésre álló MMP-szubsztrátjaik profilja. Például az MMP -k blokkolása az SCI korai szakaszában stabilabbá teheti a gátat, csökkentheti az apoptózist és megvédheti az idegsejteket. Az SCI krónikus fázisában azonban a gliális hegek kialakulása befolyásolja az extracelluláris fehérjék növekedését (Mirzaie et al., 2018).

Az MMP -k fordítása és módosítása révén szubsztrátjaik jobban kötődhetnek az extracelluláris mátrixhoz. Azt találták, hogy az MMP glikozilezése jelentősen javítja az extracelluláris mátrixhoz való kötődésüket (Agarwal et al., 1999). Az MMP9, mint a leggyakoribb glikozilezett MMP-termék, nemcsak a katalitikus doménben található N-kapcsolt Asn120 glikozilációs helyeket, hanem a pro-domén N-kapcsolt glikozilációs helyeit is tartalmazza (Vandooren et al., 2013). Beszámoltak arról, hogy az Asn38 és a galectin 8 glikozilációja növeli az MMP3 által közvetített feldolgozást, és az Asn38 és a galectin 3 glikozilációja csökkenti az MMP9 proteolitikus aktiválását. Ezért úgy tűnik, hogy az MMP9 aktivitását befolyásolja az N-glikoziláció (Boon et al., 2019). Duellman és mtsai. (2015) kimutatták, hogy az MMP9 glikozilációjának gátlásával az Asn120 -nál a calreticulin és az MMP9 közötti kölcsönhatás hatása erősíthető, és csökkenthető a szekréciós hatékonysága.

Az MMP-t foszforilezéssel lehet szabályozni, és az olyan foszforilációs helyeket, mint a Ser- és Thr-, az MMP tartományának tanulmányozásával lehet azonosítani (Ardito et al., 2017). Egyes kutatók azt találták, hogy a protein-kináz C szabályozó szerepet játszik az MMP-2 foszforilációjában (Sariahmetoglu et al., 2007). Yu és mtsai. (2000) megerősítette, hogy a GAG család tagjaként a heparán-szulfát közvetítheti a kapcsolatot a sejtfelszín és a kiválasztott gerinces MMP-k között, és ez a közvetítési kapcsolat specifikus, tekintettel arra, hogy az oldható heparin feleslege kivonja és szolubilizálja az MMP-2, MMP-t -13, MMP-7 és MMP-9. Korábbi tanulmányok kimutatták, hogy a heparin, egy erősen szulfatált heparán -szulfát, a heparán -szulfát mellett befolyásolja az MMP9 expresszióját és plazmaszintjét, valamint növeli a TIMP3 affinitását az MMP2, MMP7 és MMP9 iránt (Mannello et al., 2008) . Ezért a PTM-ek úgy tekinthetők, hogy módosítják az MMP-k több helyét, ezáltal különböző mértékben befolyásolják azok aktivitását, és ez a folyamat befolyásolhatja az SCI-t követő regenerációt.

Choi et al. (2007) arról számoltak be, hogy az extracelluláris mátrixban sok adhéziós fehérje található, ezek egyike az oszteopontin, amely egy oldható citokin, amelyet mikroglia és asztrociták képeznek. Az osteopontin sokféleképpen módosítható, például szulfatálással és glikozilezéssel, és a CD44 receptoron keresztül különböző integrinekhez kötődhet, hogy lehetővé tegye az élőlények számára, hogy különböző élettani funkciókat végezzenek (Sodek és mtsai, 2000). Gliem és mtsai. (2015) szerint az osteopontin számos élettani funkcióban vesz részt in vitro, amely révén megelőzheti az idegrendszer károsodását és az agyi ödémát. Hasonlóképpen Plantman (2012) arról számolt be, hogy az oszteopontin mátrix elősegítheti az axonnövekedést in vitro.

Az SCI után megjelenő fibrotikus hegek fibronektinből és lamininből állnak, fokozott lerakódással a léziómagban, és csökkent az asztrociták penumbralis területén (Orr et al., 2018). Az alaphártya a heg egyik legfontosabb szerkezete, míg az alapmembránok magja egy sűrű kollagén IV hálózatból áll, amely nagy szupramolekuláris szerkezetet képez. Ez a magszerkezet stabil állványt hoz létre, amelyhez a kapcsolódó fehérjék és tapadó sejtek kötődhetnek (Sanderson et al., 2019). A transzláció után a sejt lefordítja és módosítja az újonnan szintetizált kollagént IV olyan folyamatok révén, mint a glikozilezés és a hidroxilezés (Hennet, 2019). Korábbi kutatások szerint a kollagén IV gátolja a kollagén szintézisét, ezáltal megakadályozza, hogy a szervezet alapmembránt képezzen. Ily módon elősegíthető a sérült idegrendszeri axonok regenerációja (Stichel et al., 1999).

A központi idegrendszerben két oligomer többdoménes anti-adhéziós fehérje, a tenascin-C és a tenascin-R termelődik. Ezek a fehérjék számos élettani tevékenységben vesznek részt, például a növekedési faktorok és a sejtek közötti reakcióban, a sejtek tapadásában és a neuronok migrációjában (Giblin et al., 2015). A tenascin-C több glikozilációs helyén keresztül glikoziláción mehet keresztül, amiről azt találták, hogy növeli az egér neuronális őssejtek proliferációs képességét (Yagi et al., 2010). Ezenkívül a Tenascin-C erősebb kötődési képességgel is rendelkezhet módosítás révén. Giblin és mtsai. (2015) szerint ez a proteolitikus hasításnak köszönhető. A test fejlődése szabályozza a TN-R glikozilációját, és befolyásolja annak mozgékonyságát és migrációját (Woodworth et al., 2004). Beszámoltak arról, hogy a TN-R összekapcsolható a PTM-mel, ha a TN-R-t bizonyos tömegarányú szulfatálásnak vetik alá (Zamze és mtsai., 1999).

Becslések szerint 80 és 37 SCI -s beteg nyilvánvaló fájdalommal rendelkezik, amely áramütésre vagy égésre hasonlít (Mehta et al., 2019). Az SCI utáni fájdalom komolyabb hatással van a betegek mindennapi életére, mint a diszkinézia, és súlyosan csökkentheti az életminőséget (Finnerup és mtsai, 2001). A neuropátiás fájdalom hátterében komplex mechanizmusok állnak, és egyes kutatók azt állították, hogy az SCI gátlókörök elvesztését okozza a sérült rész hátsó szarvában, így kialakul a hiperaktív nociceptív jelzés, és tovább fokozódik a fájdalomérzékenység (hiperalgézia) és mechanikus túlérzékenység ( allodynia) (Meisner et al., 2010). Egyes kutatók előterjesztették a központi idegrendszer maladaptív plaszticitási hipotézisét is, amely szerint a maladaptív plaszticitás a neuropátiás fájdalom fő oka SCI-ben. Más kutatók úgy vélik, hogy a D1/5 receptor által közvetített ERK foszforiláció csökken az SCI után, és a dopamin D1 receptorok elvesznek a vízvezetéket körülvevő szürkeállományban (Voulalas et al., 2017).

Garcia-Larrea és mtsai. (2013) arról számoltak be, hogy a neuropátiás fájdalomban szenvedő egyének gyakran az insuláris kéreg túlzott aktivációját mutatják. Az izolált kéreg gerjesztő szinaptikus átvitelét befolyásolja a α-amino-3-hidroxi-5-metil-4-izoxazol-propionsav receptor (AMPAR). Az insuláris kéreg AMPAR funkciója gyakran túl aktív neuropátiás fájdalomban szenvedő egyénekben (Koga és mtsai, 2012). Qiu et al. (2014) arról számoltak be, hogy a szinaptikus GluA1, amely az AMPAR alegysége, mennyisége megnövekszik az SCI után, és a GluA1 foszforilációja az Slu845-nél szükséges a szinaptikus AMPAR-ok fokozásához. Ezért nyilvánvaló, hogy a GluA1 foszforiláció fontos hatással van a szigetkéreg neuropátiás fájdalmára. Szoros kapcsolat van a neuropátiás fájdalom kialakulása és az izolált kéreg N-metil-D-aszpartát (NMDA) receptorok (NMDAR) szintje között is. Az NMDAR-ok GluN2B alegysége olyan patofiziológiai folyamatokban vesz részt, mint a fájdalomérzékelés és az ischaemiás károsodás, és az agy posztszinaptikus denzitású fehérjéinek egyik fő tirozin-foszforilált fehérje. Beszámoltak arról, hogy a GluN2B alegység foszforilációs szintje a gerincvelő felszíni hátsó szarvában jelentősen megnő 7 nappal az SCI után, és hogy a Fyn kináz közvetítheti ezt a foszforilációt (Abe et al., 2005). Egyes kutatók génkiütési technológiát alkalmaztak az Y1472 kiütésére egerekben, és Tyr1472-vel helyettesítették, ezáltal csökkentve a GluN2B mennyiségét az Y1472 foszforilációs helyén a szervezetben. Ebben a modellben a knockout egerek fájdalma szignifikánsan alacsonyabb volt, mint a knockout nélküli egerek fájdalma (Nakazawa és mtsai, 2006 Katano et al., 2011). Összefoglalva, úgy tűnik, hogy az AMPAR és NMDAR alegységek foszforilációja fontos szerepet játszik a neuropátiás fájdalomban.

Bebizonyosodott, hogy a glia és az idegsejtek közötti keresztbeszélgetés számos központi idegrendszeri folyamathoz kapcsolódik, mint például a neurogenezis, a mielinizáció, a szinapszisképződés, az idegsejtek migrációja, a proliferáció és a differenciálódás, valamint a neuronális jelátvitel (Gomes et al., 2001). Például az SCI után aktivált gliasejtek proinflammatorikus citokineket, neurotranszmittereket, ROS/RNS -t és ATP -t választanak ki, amelyek ezután a CREB és az ERK foszforilációját indukálják. Ez a PTM modulálja a szenzoros neuronális hiperaktivitást és a központi neuropátiás fájdalmat az SCI után (Crown et al., 2006).

Évszázadok óta folyamatos erőfeszítések történtek az SCI optimális kezelési stratégiájának meghatározására, annak ellenére, hogy a funkcionális károsodás elkerülhetetlen. A prognózis a sérülés különböző szintjeitől függően változik, és a sikeres axon-regeneráció két vagy több gerincszinten nagy változást jelenthet a C6/7-es nyaki lézióban szenvedő betegek számára, mivel ez segíthet a rekeszizom bizonyos mértékének visszaállításában kéz- és ujjellenőrzés foka. A nyaki gerincben az egyes gerincszegmensek magassága 1 cm, így az idegregeneráció nehezen haladja meg a 2 cm-t. A regeneráció legegyértelműbb akadálya a belső axon regenerációs képességének elvesztése és az ellenséges külső környezet.

E nehézségek leküzdése érdekében a kutatók megvizsgálták a SCI -ben végzett farmakológiai beavatkozások hatékonyságát. A klinikai gyakorlatban az orvosi személyzet gyakran alkalmaz metilprednizolont, amely képes fenntartani a vér-gerincvelő gátat és elnyomni a gyulladást (Chio et al., 2020). A kapcsolódó kutatások azt is kimutatták, hogy a metilprednizolon esetenként súlyos mellékhatásokat, például tüdőgyulladást és gyomor-bélrendszeri vérzést okozhat, amelyek súlyos esetekben halálhoz is vezethetnek (Ko, 2019). Bár számos klinikai vizsgálatot végeztek a naloxonnal, a tirotropint felszabadító hormonnal és a monosialotetrahexo-szilganglioziddal kapcsolatban (Badhiwala et al., 2018), nem találtak jelentős javulást. Más kísérleti stratégiákat is jól tanulmányoztak, mint például a gliális hegképződés blokkolását (Rhodes et al., 2004), ciszták és hegek áthidalását, a reaktív asztrociták szelektív eltávolítását (Vismara és mtsai, 2019), a növekedést gátló módosítását. molekulák (Fournier et al., 2001) és sejtpótlás (Schwann -sejtek, embrionális őssejtek, pluripotens őssejtek, mesenchymális őssejtek és szaglósejtek (Zhao et al., 2016 Zavvarian et al., 2020), génterápiák (Uchida és mtsai., 2014), valamint a kombinált terápiás beavatkozások (Griffin és mtsai, 2020). Az ígéretes eredmények hiánya az SCI alapjául szolgáló patofiziológiai mechanizmusok összetettségének tulajdonítható. Ezért a különböző módszerek, a különböző gyógyszerek kombinálása segíthet megvédeni az SCI-ben szenvedő betegek idegeit. Chen és munkatársai (2007) felfedezték, hogy az AMPAR-k és az NMDAR-ok alegység-foszforilációja jelentősen csökkenti az egerek neuropátiás fájdalmát. azt jelzi, hogy a foszforiláció egyszeri megcélzása kombináló hatást válthat ki.

Több mint 20 éve kimutatták, hogy a kondroitináz ABC csökkenti a CSPG gátlását az SCI kísérleti modelljeiben, és ez a módszer a CSPG-nek az SCI utáni axonnövekedésre gyakorolt ​​gátló hatásáról szóló tudásunkon alapul (Zuo et al., 1998). A CSPG -k azonban fontosak az axon -útkeresésben és az irányításban is (Schwartz et al., 2018). Ezenkívül az állatkutatások többségét ezzel a terápiás hatással viszonylag rövid időn belül, napoktól hetekig végezték, és a hosszú távú vizsgálatok még mindig hiányoznak. Eddig a kondroitináz ABC klinikai potenciálja még mindig nem világos. Valójában az ABC kondroitináz alkalmazása akut SCI-ben radikális és visszafordíthatatlan CSPG-emésztéshez vezet, és az emberek hosszú távú hatásait nem tisztázták. Ez azonban érdekes lehet, ha képesek vagyunk elnyomni a CSPG hatását csak az axonnövekedésre, és visszafordíthatóan szabályozni ezt a hatást. Érdekes módon a jelen áttekintésben tárgyalt munka szerint a tubulin acetiltranszferáz-1 (αTAT1 acetiláció) közvetíti a CSPG gátló hatását az axon mikrotubulusok növekedésére. Ez az acetilező módosítás visszafordítható és minimális mellékhatásokkal jár, ezért ez a PTM jobb választás, mint a CSPG ablációja. Más szavakkal, egy molekula specifikus hatásának reverzibilis elnyomása jobb lehet, mint a molekula elnyomása.

Amint fentebb említettük, a PTM -ek és az SCI -ben betöltött szerepük rendkívül dinamikus. Ezenkívül egy adott PTM funkciója egyetlen fehérjénél eltérő különböző időpontokban és különböző környezetekben. Például egy adott PTM előnyös lehet az SCI utáni elsődleges sérülés során, de káros lehet a második szakaszban. Így a terápiás PTM -eknek szabályozhatónak kell lenniük. Általában a transzkripció, az RNS -szerkesztés és a fordítás folyamata visszafordíthatatlan. A fehérjék harmadlagos szerkezetét csak az exonok kiválasztása és összeillesztése után lehet konformációs ingadozásokkal megváltoztatni. Számos erősen szabályozható PTM létezik, amelyek közül sok reverzibilis folyamatokat foglal magában, míg a molekula foszforilezési állapota (nem foszforilezett vagy foszforilált) reverzibilis. Ez kiemeli a PTM -eket, mint ideális terápiás célpontokat az SCI térbeli és időbeli terápiás követelményeinek megfelelően. A PTM-ek megcélzásának másik előnye, hogy a hatások viszonylag azonnaliak, mivel az aminosavmaradékok PTM-hez kapcsolódó változásai azonnal átalakítják a fehérjeaktivitást, a celluláris elhelyezkedést és a dinamikus kölcsönhatásokat más fehérjékkel. Ez az időszerű hatás az SCI gyors romlása és kóros folyamatainak eltolódása miatt kedvező.

A terápiás alkalmazásokon kívül a PTM -ek az SCI biomarkereként is használhatók. Caprelli és mtsai. (2019) arról számoltak be, hogy a hiperfoszforilezett és hasított tau a központi idegrendszer károsodásának érzékeny biomarkerei lehetnek, amelyek következetes és megbízható értékelést nyújthatnak a sérülés jelenlétéről és súlyosságáról, valamint a gyógyulás prognózisáról.

Annak ellenére, hogy az SCI-ben a PTM-célzó terápia előnyei vannak, meg kell jegyezni annak korlátait is. Először is, a sok PTM célkitűzése változatos, ami megnehezíti ezen PTM -ek farmakológiai célzását. Másodszor, a PTM-funkciók az SCI utáni időpontok szerint különböznek, és nehéz megerősíteni a PTM-ek célzásának optimális időpontját. Végül az SCI utáni neuronális regenerációs kudarc számos tényezőnek tulajdonítható, és egy specifikus PTM, amely csak a belső regenerációs kapacitást vagy a gátló molekuláris vagy gliális hegképződést modulálja, nem elegendő az érdemi gyógyulás biztosításához.

A legtöbb SCI -s beteg esetében a teljes gyógyulás nem valószínű és nehezen elérhető. A terápiás stratégiáknak a lépésről lépésre történő funkcionális helyreállításra és az életminőség javítására kell összpontosítaniuk, a PTM-terápia vizsgálatának pedig a neuropátiás fájdalom szabályozását kell előtérbe helyeznie a motoros vagy érzékszervi helyreállítással szemben. A biztató munka feltárta a PTM-ek szerepét a neuropátiás fájdalom csillapításában. Ezenkívül az axonregenerációt gátló tényezők változatosak, ezért több tényezőt célzó PTM-ek kombinációját is meg kell vizsgálni. Ezenkívül más terápiás stratégiák, mint például a sejttranszplantáció és a génterápia, jelentősen növelhetik a PTM-indukálta moduláció hatását.

A szerző hozzájárulása: Adománygyűjtés, kézirat-tervezés és fogalmazás: SZ, LJL, QC adatgyűjtés: BSY, SJL, GT adatelemzés: JYT, GFW, LL, GLC. Valamennyi szerző jóváhagyta a dolgozat végleges változatát.

Összeférhetetlenség: A szerzők kijelentik, hogy nincsenek egymással versengő érdekeik.

Pénzügyi támogatás: Ezt a munkát a Kínai Nemzeti Természettudományi Alapítvány támogatta, 81801210 (SZ-nek).

Szerzői jogi licencszerződés: A szerzői jogi licencszerződést a közzététel előtt minden szerző aláírta.

Plágium ellenőrzése: Az iThenticate kétszer ellenőrizte.

Szakértői értékelés: Külső szakértői értékelés.

Nyílt szakértői véleményezők: Lukas Grassner, Murnau Trauma Center, Németország Rodolfo Gabriel Gatto, Chicago Illinois -i Egyetem, USA Mitsuhiro Enomoto, Tokyo Medical and Dental University, Japán.

Kiegészítő fájl: Nyissa meg az 1., 2. és 3. szakértői felülvizsgálati jelentést[1. kiegészítő fájl].

Finanszírozás: Ezt a munkát a Kínai Nemzeti Természettudományi Alapítvány támogatta, 81801210 (SZ).

P-lektorok: Grassner L, Gatto RG, Enomoto M C-Szerkesztők: Zhao M, Qiu Y T-Szerkesztő: Jia Y


Absztrakt

A köztes szálak (IF) olyan citoszkeletális és nukleoszkeletális struktúrák, amelyek mechanikai és stresszel szembeni ellenálló képességet biztosítanak a sejtek számára, hozzájárulnak a szubcelluláris és szövetspecifikus biológiai funkciókhoz, és megkönnyítik az intracelluláris kommunikációt. Az IF-ket, beleértve a nukleáris rétegeket és a citoplazmában lévőket (többek között keratinok, vimentin, dezmin, neurofilamentumok és gliás fibrilláris savas fehérje), funkcionálisan a transzláció utáni módosítások (PTM-ek) szabályozzák. A proteomikai fejlesztések rávilágítanak az IF fehérje PTM-ek óriási összetettségére és szabályozási potenciáljára, amelyek magukban foglalják a foszforilációt, a glikozilációt, a szumoilezést, az acetilezést és a prenilációt, miközben az új módosítások egyre inkább felértékelődnek. A jövőbeni tanulmányoknak jellemezniük kell be- és kikapcsolási mechanizmusaikat, áthallásukat és biomarkerként való hasznosságát, valamint az IF citoszkeletont érintő betegségek célpontjait.


Hyp/Pro-gazdag fehérjék

Az EXT-ekhez és az AGP-ekhez hasonlóan a H/PRP-k is a HRGP szupercsaládhoz tartoznak, és néhányuk kiméra fehérje. Amint fentebb említettük, keveset tudunk a O-a H/PRP glikozilezése és kölcsönhatásuk a poliszacharidokkal. Tekintettel a O-glikoziláció, az információ csak az X(Pro/Hyp)-t tartalmazó H/PRP-kről áll rendelkezésren ≥ 2X motívum. Ez a típusú domén társítható egy rövid N-terminális AGP doménhez, egy hisztidin (His) -stretchhez és egy C-terminális PAC (Prolinban gazdag fehérje és AGP, Cys-t tartalmazó) doménhez, mint a A. thaliana AtAGP31 (Liu és Mehdy, 2007 Hijazi et al., 2012). Eddig tizenkét ilyen fehérjét azonosítottak A. thaliana, Daucus carota, Gossypium hirsutum, Nicotiana alata, N. tabacum, Phaseolus vulgaris, Capsicum annuum és Petunia hybrida (Hijazi et al., 2014).

A szerkezete O-AtAGP31 típusú H/PRP glikánok

O-az AtAGP31 H/PRP doménjének glikozilezett aminosav -motívumait tömegspektrometriával jellemezték: Lys (Ala/Ser) HypVal, Lys (Pro/Hyp) (Hyp/Pro) (Thr/Val), Thr (Pro/Hyp ) (Hyp/Pro) Val és Tyr (Pro/Hyp) (Hyp/Pro) Thr (Hijazi et al., 2012). A Hyp-hez kapcsolódó monoszacharid egy hexóz, amely a tisztított fehérje monoszacharid-analízise alapján nagy valószínűséggel Gal (53,2% Gal, 39,5% Ara, 2,2% Xyl, 1,9% Fuc, 1,8% Glc, 1,3% Man, 0,3% GlcUA). Meg kell jegyezni, hogy ez a globális elemzés magában foglalja O-glikánok kapcsolódnak az AtAGP31 AGP doménjéhez és N-PAC doménjéhez kapcsolódó glikánok. Az O-Az AtAGP31 H/PRP doménjéhez kapcsolódó glikánt a β-D-glucosyl Yariv reagens nem ismeri fel, de kölcsönhatásba lép a földimogyoró-agglutininnel (PNA), egy olyan lektinnel, amely nagy affinitással rendelkezik a Gal-maradékokhoz (Hijazi et al. ., 2012). Gal/Ara-gazdag motívumnak nevezték (Hijazi et al., 2012). Nicotiana alata A NaPRP4 azonos típusú H/PRP doménnel és PAC doménnel rendelkezik az AtAGP31-gyel (Sommer-Knudsen és mtsai, 1996). Ennek a domináns monoszacharidja O-a glikoprotein Gal (83%), míg az Ara, GlcNac, Man, Xyl területek kis mennyiségben (7, 4, 4, 1%) találhatók. A kapcsolódási elemzés kimutatta a terminális Ara jelenlététf (6%), Galp (48%), 1,3-Galp (4%), 1,6-Galp (14%), 1,3,6 Galp (25%), 1,2-Manp (1%) és Xylp (1%). Összességében H/PRP X(Pro/Hyp)n ≥ 2X motívumok azok O-Gal-Ara-ban gazdag glikánokkal glikozilezett, ami kissé eltér a korábban leírt I., II. és III. típusú AG-któl. Ezen struktúrák teljes körű leírásához további jellemzésre lesz szükség, különösen az NMR segítségével.

A H/PRP kölcsönhatásai poliszacharidokkal

Feltételezik, hogy a H/PRP-k térhálósodnak a sejtfalban, de a közvetlen bizonyíték még mindig hiányzik (Bradley és mtsai, 1992 Brisson és mtsai, 1994 Frueauf et al., 2000). A lehetséges szerepekről semmit sem lehet tudni O- glikozilációk. Az AtAGP31-t nemrég javasolták, hogy vegyenek részt nem kovalens interakciós hálózatokban (Hijazi et al., 2014). Következetesen és ellentétben a HRGP -kkel, amelyek kovalensen oldhatatlanok a sejtfalakban, az AtAGP31 könnyen kivonható az etiolált hipokotilok sejtfalából (Hijazi et al., 2012). Megjegyzendő, hogy a NaPRP4 sem oldódik fel a sejtfalban (Sommer-Knudsen és mtsai, 1996). Az AtAGP31 kölcsönhatásba lépett in vitro típusú RGI típusú AG-val a PAC doménjén keresztül, és metil-észterezett poligalakturonsavval, valószínűleg His-szakaszán keresztül. Fehérje/fehérje kölcsönhatásokat feltételeztünk az AtAGP31 esetében is, i. Önfelismeréssel a PAC domén és a H/PRP domén között O-glikánok, és (ii) kölcsönhatás a sejtfal lektinjeivel. Javasolták, hogy az AtAGP31 többdoménes szervezet összetett szupermolekuláris állványokat eredményez különböző sejtfal-összetevőkkel, ezáltal hozzájárulva a gyorsan növekvő szervek, például az etiolált hipokotilok sejtfalának megerősítéséhez. Ilyen nem kovalens hálózatokat korábban nem írtak le a HRGP-khez. Hasonló viselkedés állhat fenn az AtAGP31-gyel megosztó fehérjék esetében is (Hijazi et al., 2014). Azonban, mint fentebb említettük, kivéve a NaPRP4-et, amelynek glikozilációját jellemezték (Sommer-Knudsen és mtsai, 1996), ezeket a fehérjéket nem írták le molekuláris szinten, és nem vizsgálták kölcsönhatásukat a sejtfal poliszacharidjaival. TTS-1 és TTS-2 (átviteli szövetspecifikus) N. tabacumés DcAGP1 innen D. carota kimutatták, hogy ellipszoid alakúak, és mikroszkópos technikák alkalmazásával magasabb rendű struktúrákba önthetők össze (Baldwin et al., 2000, 2001 Wu et al., 2001). Érdekes módon a TTS deglikozilációja megzavarja aggregációs képességét, ami arra utal, hogy az önasszociáció szabályozása a szintje által. O-glikozilezés (Wu et al., 1995). Önszerelés fej-farok módban a kölcsönhatások révén O-a H/PRP domén és a PAC domén glikánjai javasolhatók olyan fehérjékhez, mint a TTS és a DcAGP1, hasonlóan az AtAGP31 -hez.


Tartalom

Hozzáadás enzimmel in vivo Szerkesztés

Hidrofób csoportok membrán lokalizációhoz Szerk

    (az acilezés egy fajtája), mirisztát kötődése, egy C14 telített sav (az acilezés egyik típusa), palmitát kötődése, a C16 telített sav vagy preniláció, izoprenoid csoport hozzáadása (például farnezol és geranilgeraniol)

Kofaktorok a fokozott enzimaktivitásért Szerkesztés

    (acilezés egy fajtája), lipoát kötődése (C8) funkciós csoport (FMN vagy FAD) kovalensen kapcsolódhat tioéter kötéseken keresztül ciszteinekkel, egy 4'-foszfopanteteinil-rész hozzáadásával a koenzim A-ból, például zsírsav-, poliketid-, nem-riboszómális peptid- és leucin-bázis bioszintézisben.

Fordítási tényezők módosításai Szerk

    képződés (az eEF2 -ben található hisztidinhez) kötődés (az eEF1α -ban található glutamáton) [8] képződés (az eIF5A (eukarióta) és aIF5A (archeal) konzervált lizinjén) hozzáadása a P megnyúlási faktor (EFP) konzervált lizinjéhez a legtöbb baktérium. [9] Az EFP az eIF5A (eukarióta) és az aIF5A (archaeal) homológja (lásd fent).

Kisebb kémiai csoportok Szerk

    , például. O-acilezés (észterek), N-acilezés (amidok), S-acilezés (tioészterek)
      , egy acetilcsoport hozzáadása a fehérje N-terminálisán[10] vagy a lizin-maradékokhoz. [11]Lásd még a hiszton -acetilezést. [12] [13] A fordítottját deacetilezésnek nevezik.
      metilcsoport hozzáadása, általában lizin- vagy arginincsoportoknál. Ennek fordítottját demetilációnak nevezik.
      kiegészítés
        , tRNS-közvetítő adalék, glutaminsav-maradékok kovalens kötése a tubulin és néhány más fehérje N-terminálisához. [15] (Lásd a tubulin-poliglutamilázt), egy-több mint 40 glicin-kovalens kötés a tubulin C-terminális farokkal
        , kiegészítése N-acetil-glükózamin szerin- vagy treoninmaradékká β-glikozidos kötésben
      • poliszialiláció, poliszialinsav, PSA hozzáadása az NCAM -hoz
        foszfátcsoport hozzáadása, általában szerinhez, treoninhoz és tirozinhoz (O-linkelt) vagy hisztidin (N-linkelt), adenilil -rész hozzáadása, általában tirozinhoz (O-kapcsolt), vagy hisztidin és lizin (N-linkelt)
      • uridilezés, uridilil-csoport (azaz uridin-monofoszfát, UMP) hozzáadása, általában tirozinhoz

      Nem enzimatikus adalékok in vivo Szerkesztés

        , cukormolekula hozzáadása egy fehérjéhez enzim kontrolláló hatása nélkül. izocianinsav hozzáadása a fehérje N-terminálisához vagy a Lys oldalláncához. [18] szén -monoxid hozzáadása más szerves/szervetlen vegyületekhez.
      • spontán izopeptid kötés kialakulása, amint azt a Gram-pozitív baktériumok sok felszíni fehérjéjében megtaláljuk. [19]

      Nem enzimatikus adalékok in vitro Szerkesztés

        : biotinrész kovalens kötése biotinilező reagens alkalmazásával, jellemzően fehérje megjelölése céljából.
      • karbamiláció: izociansav hozzáadása a fehérje N-terminálisához vagy a Lys vagy Cys oldalláncához, amely jellemzően karbamidoldatokkal való érintkezés eredménye. [20]
      • oxidáció: egy vagy több oxigénatom hozzáadása egy érzékeny oldallánchoz, elsősorban Met, Trp, His vagy Cys csoportokhoz. Diszulfidkötések kialakulása a Cys -maradékok között. : polietilénglikol (PEG) kovalens kötése pegilációs reagens használatával, jellemzően az N-terminálishoz vagy a Lys-maradékok oldalláncához. A pegilációt a fehérjegyógyszerek hatékonyságának javítására használják.
      • ISGiláció, kovalens kötés az ISG15 fehérjéhez (Interferon-stimulated Gene 15) [21], kovalens kötés a SUMO fehérjéhez (Small Ubiquitin-related MOdifier) ​​[22], kovalens kötés az ubiquitin fehérjéhez. , a kovalens kötés Nedd-hez, a kovalens kötés a prokarióta ubiquitin-szerű fehérjéhez
        , vagy deimináció, arginin átalakulása citrullinná[23], glutamin glutaminsavvá vagy aszparagin átalakítása aszparaginsavvá, alkénné átalakítása a foszfotreonin és foszfoszerin béta-eliminációjával, vagy a treonin és a szerin dehidratálása[24]
        , két cisztein aminosav kovalens kötése, egy fehérje hasítása peptidkötés kialakulása során aszparagin vagy aszparaginsav aminosavak ciklizálása révén
        • a szerin fehérje-szerin epimeráz segítségével
        • alanint tartalmaz a dermorfinban, egy béka opioid peptidben
        • metionin deltorfinban, szintén béka opioid peptid

        Gyakori PTM-ek frekvencia szerint Szerkesztés

        2011-ben a Swiss-Prot adatbázisból származó, proteomszintű információk felhasználásával statisztikát állítottak össze minden kísérletileg és feltételezhetően észlelt poszttranszlációs módosításról. [25] A 10 leggyakoribb kísérletileg talált módosítás a következő volt: [26]

        Frekvencia Módosítás
        58383 Foszforiláció
        6751 Acetilezés
        5526 N-kapcsolt glikoziláció
        2844 Amidáció
        1619 Hidroxilezés
        1523 Metilezés
        1133 O-kapcsolt glikozilezés
        878 Mindenütt jelenlét
        826 Pirrolidon -karbonsav
        504 Szulfatálás

        Gyakori PTM -ek maradék szerint Szerkesztés

        Az alábbiakban bemutatunk néhány általános poszttranszlációs módosítást specifikus aminosavmaradékokra. A módosítások az oldalláncon történnek, hacsak másképp nem jelezzük.

        Aminosav Abbrev. Módosítás
        Alanin Ala N-acetilezés (N-terminális)
        Arginin Arg dezmináció citrullinná, metilezés
        Spárga Asn dezamidálás Asp-vé vagy izo(Asp), N-kapcsolt glikoziláció
        Aszparaginsav Áspiskígyó izomerizáció izoaszparaginsavvá
        cisztein Cys diszulfid kötés képződése, oxidáció szulfénsavvá, szulfinsavvá vagy szulfonsavvá, palmitoilezés, N-acetilezés (N-terminális), S-nitroziláció
        Glutamin Gln ciklizálás piroglutaminsavvá (N-terminális), dezamidálás glutaminsavvá vagy izopeptid kötés kialakulása lizinné transzglutamináz által
        Glutaminsav Glu ciklizálás piroglutaminsavvá (N-terminális), gamma-karboxilezés
        Glicin Gly N-mirisztoiláció (N-terminális), N-acetilezés (N-terminális)
        Hisztidin Övé Foszforiláció
        Izoleucin Ile
        Leucin Leu
        Lizin Lys acetilezés, ubiquitináció, SUMOiláció, metilezés, hidroxilezés
        metionin Találkozott N-acetilezés (N-terminális), N-kapcsolt Ubiquitination, oxidáció szulfoxiddá vagy szulfonná
        Fenilalanin Phe
        Prolin Pro hidroxilezés
        Serine Ser Foszforilezés, O-kapcsolt glikoziláció, N-acetilezés (N-terminális)
        Treonin Thr Foszforilezés, O-kapcsolt glikozilezés, N-acetilezés (N-terminális)
        Triptofán Trp mono- vagy di-oxidáció, kinurenin, triptofán-triptofil-kinon képződése
        Tirozin Tyr szulfatálás, foszforiláció
        Valine Val N-acetilezés (N-terminális)

        A fehérjeszekvenciák olyan szekvenciamotívumokat tartalmaznak, amelyeket a módosító enzimek felismernek, és amelyek dokumentálhatók vagy előre jelezhetők a PTM adatbázisokban. A felfedezett különféle módosítások nagy száma miatt szükség van az ilyen jellegű információk adatbázisokban való dokumentálására. A PTM információk gyűjthetők kísérleti eszközökkel, vagy megjósolhatók kiváló minőségű, kézzel kurált adatokból. Számos adatbázist hoztak létre, amelyek gyakran bizonyos taxonómiai csoportokra (például emberi fehérjékre) vagy más jellemzőkre összpontosítanak.

        Források listája Szerkesztés

          [28] – Átfogó információkat és eszközöket tartalmazó adatbázis az emlős fehérjék poszttranszlációs módosításának tanulmányozásához [29] – Fehérjék és poszttranszlációs módosítások kísérleti adatbázisa [29] – Adatbázis a különböző módosításokhoz és a különböző fehérjék megértéséhez, azok osztály, valamint a betegségeket okozó fehérjékkel kapcsolatos funkció/folyamat [30] - A PTM -ek sok típusának konszenzusmintáinak adatbázisa, beleértve a helyeket (PIR) [31] - Adatbázis a PTM -ek megjegyzéseinek és szerkezeteinek gyűjteményéhez. [27] – A különböző PTM-eket és a kémiai komponenseikre/szerkezetükre vonatkozó információkat, valamint az aminosav-módosított hely gyakoriságát bemutató adatbázis rendelkezik PTM-információkkal, bár ez kevésbé átfogó, mint a speciálisabb adatbázisokban.

        Eszközök Szerkesztés

        A fehérjék és a PTM -ek megjelenítésére szolgáló szoftverek listája

          [34] - közös PTM -ek bevezetése a fehérjemodellekbe [35] - Interaktív eszköz az egyetlen nukleotid polimorfizmusok szerepének megismerésére a PTM -ekben [36] - Interaktív adatbázis a molekulák megjelenítéséhez
        • Hasadás és diszulfid hidak kialakulása az inzulin termelése során
        • A hisztonok PTM-je, mint a transzkripció szabályozása: RNS polimeráz szabályozása kromatin szerkezettel
        • Az RNS polimeráz II PTM -je, mint a transzkripció szabályozása
        • A polipeptidláncok hasítása a lektinspecifitás szempontjából kulcsfontosságú [37]

        A függőség fő jellemzője a tartóssága. Az addiktív fenotípus egész életen át tartó lehet, a kábítószer-sóvárgás és a visszaesés akár több évtizedes absztinencia után is előfordulhat. [38] A függőségek molekuláris alapja szempontjából döntő fontosságúnak tűnnek a poszttranszlációs módosítások, amelyek a hisztonfehérje farok epigenetikus elváltozásaiból állnak az agy bizonyos régióiban. [38] [39] [40] Ha bizonyos poszt-transzlációs epigenetikai módosítások bekövetkeznek, úgy tűnnek, hogy azok hosszú távú "molekuláris hegek", amelyek a függőség fennmaradását okozhatják. [38] [41]

        A cigarettázók (2013-ban az Egyesült Államok lakosságának körülbelül 21%-a) [42]) általában nikotinfüggők. [43] Az egerek 7 napos nikotinkezelése után a H3 és a H4 hiszton acetilezéséből álló transzláció utáni módosítások megnövekedtek az agy sejtmagjának FosB promoterében, ami 61% -os növekedést okozott a FosB expressziójában. [44] Ez növeli a Delta FosB illesztési változat expresszióját is. Az agy sejtmagjában a Delta FosB "tartós molekuláris kapcsolóként" és "vezérlő fehérjeként" működik a függőség kialakulásában. [45] [46] Hasonlóan, patkányok 15 napos nikotinkezelése után a poszttranszlációs módosulás, amely a H4 hiszton háromszoros megnövekedett acetilációjából áll, a dopamin D1 receptor (DRD1) gén promóterén megy végbe a prefrontális kéregben. PFC) a patkányokban. Ez fokozott dopamin-felszabadulást okozott a PFC jutalommal összefüggő agyi régiójában, és az ilyen fokozott dopamin-felszabadulást a függőség fontos tényezőjeként ismerik el. [47] [48]

        Az Egyesült Államok lakosságának körülbelül 7% -a alkoholfüggő. Legfeljebb 5 napig alkoholnak kitett patkányokban megnövekedett a hiszton 3 lizin-9 acetilációjának (H3K9ac) poszttranszlációs módosulása az agy amygdala komplexében lévő pronociceptin promoterben. Ez az acetilezés a pronociceptin aktiváló jele. A nociceptin/nociceptin opioid receptor rendszer részt vesz az alkohol megerősítő vagy kondicionáló hatásában. [49]

        A kokainfüggőség az Egyesült Államok lakosságának körülbelül 0,5%-ában fordul elő. A kokain ismételt beadása egerekben transzláció utáni módosításokat indukál, beleértve a 3-as hiszton (H3) vagy a 4-es hiszton (H4) hiperacetilálását 1696 génnél egy agyi jutalmazási régióban [a nucleus accumbens] és deacetilezést 206 génnél. [50] [51] Legalább 45 génről, amelyekről a korábbi vizsgálatok azt mutatták, hogy a krónikus kokain-expozíciót követően felül szabályozzák az egerek sejtmagjában, összefüggést találtak a H3 vagy a H4 hiszton transzláció utáni hiperacetilezésével. Ezen egyedi gének közül sok közvetlenül kapcsolódik a kokain -expozícióval összefüggő függőségi aspektusokhoz. [51] [52]

        2013 -ban az Egyesült Államokban 22,7 millió 12 éves vagy annál idősebb személynek volt szüksége kezelésre egy tiltott kábítószer- vagy alkoholfogyasztási probléma miatt (a 12 éves vagy idősebb személyek 8,6 százaléka). [42]


        Jelenlegi cím: Jelenlegi cím: Kémiai Tanszék, Indiana Egyetem, Bloomington, Indiana, USA.,

        Meaghan Morris és Giselle M Knudsen: Ezek a szerzők egyformán hozzájárultak ehhez a munkához.

        Tartozások

        Gladstone Institute of Neurological Disease, San Francisco, California, USA

        Meaghan Morris, Sumihiro Maeda és Lennart Mucke

        Biológiai kémia, biokémia, sejt- és molekuláris biológia tanszék, The Johns Hopkins University School of Medicine, Baltimore, Maryland, USA

        Gyógyszerészi Kémiai Tanszék, Tömegspektrometriai Intézet, Kaliforniai Egyetem, San Francisco, California, USA

        Giselle M Knudsen, Jonathan C Trinidad, Alexandra Ioanoviciu és Alma L Burlingame

        Neurológiai Tanszék, Kaliforniai Egyetem, San Francisco, Kalifornia, USA

        Sumihiro Maeda és Lennart Mucke

        Ezt a szerzőt a PubMed Google Scholarban is keresheti

        Ezt a szerzőt a PubMed Google Scholarban is keresheti

        Ezt a szerzőt a PubMed Google Scholarban is keresheti

        Ezt a szerzőt a PubMed Google Scholarban is keresheti

        Ezt a szerzőt a PubMed Google Scholarban is keresheti

        Ezt a szerzőt a PubMed Google Scholarban is keresheti

        Ezt a szerzőt a PubMed Google Scholarban is keresheti

        Hozzájárulások

        M.M. tervezte és hajtotta végre az egérkísérleteket, a statisztikai elemzéseket és megírta a kéziratot. G.M.K. elemezte és gyűjtötte a PTM-térképezési adatokat, elvégezte a kvantitatív tömegspektrometriás kísérleteket és megírta a kéziratot. S.M. PSD frakcionálást és Western blotot végzett, és megírta a kéziratot. J.C.T. segített a tömegspektrometriai módszer kidolgozásában és megírta a kéziratot. A.I. tömegspektrometriával végzett PTM térképezési kísérleteket. A.L.B. és L. M. felügyelte a projektet és megírta a kéziratot.

        Levelezési cím


        ANYAGOK ÉS METÓDUSOK

        Az iPTMnet integráló bioinformatikai keretrendszert alkalmaz (1. ábra), hogy a különböző bioinformatikai adatbázisokból származó információkat, szövegbányászati ​​eredményeket és ontológiákat PTM-hálózatokba kapcsolja feltárás és felfedezés céljából. A rendszer fő összetevői a következők: i. Szövegbányászati ​​rendszer (lásd a 2.1. Pontot) ii. iPTMnet tudásbázis és webportál (lásd 2.6). Összességében az iPTMnet a PTM nyolc fontos típusáról – foszforilációról, ubiquitinációról, acetilezésről, metilezésről, glikozilációról, S-nitrozilációról, szumoilezésről és mirisztoilezésről – nyújt információt emberi és számos modellszervezetben.

        iPTMnet rendszerkomponensek. (1) Szövegbányászati ​​rendszer a PTM-tudás tudományos irodalomból történő kinyerésére (2) PTM-információk kiváló minőségű, kézzel kurált adatbázisokból (3) ontológiák a tudásábrázoláshoz és (4) iPTMnet tudásbázis, integrált információkkal és webes portállal, amely összekapcsolja a rendszer összetevőit támogatja az interaktív tudományos lekérdezéseket és a PTM-ek adatvizualizálását.

        iPTMnet rendszerösszetevők. (1) Szövegbányászati ​​rendszer a PTM tudás kinyerésére a tudományos irodalomból (2) PTM információk kiváló minőségű, manuálisan összeállított adatbázisokból (3) ontológiák a tudás reprezentációjához és (4) iPTMnet tudásbázis integrált információval és webportállal, amely összekapcsolja a rendszer összetevőit támogatja az interaktív tudományos lekérdezéseket és a PTM -ek adatábrázolását.

        PTM információk teljes léptékű szövegbányászata szakirodalomból

        Automatizált munkafolyamatot hoztunk létre a PubMed absztraktok és a PubMed központi nyílt hozzáférés készlet (PMCOA) teljes hosszúságú cikkeinek teljes körű feldolgozásához RLIMS-P és eFIP segítségével, amelyeket korábban értékeltünk a teljesítmény és a közösségi kihívásokban való felhasználhatóság szempontjából (21 – 24). A szövegbányászat eredményeit egy helyi adatbázis tárolja, és havonta frissíti. A tárolt információ mind entitásokat (pl. Szubsztrát, hely és interaktáns), mind kapcsolatokat (pl. Kináz-szubsztrát-hely és PPI) tartalmaz, a szövegben található megfelelő bizonyítékokkal együtt (pl. Mondatok, szakasz azonosítók és PubMed azonosítók (PMID)). A megjegyzésekkel ellátott szöveget a bizonyítékok hozzárendelésének kulcsfogalmai jelzik. A teljes szöveg esetében csak az eredmények részből kinyert információkat használjuk annak valószínűségének növelésére, hogy az információt kísérleti bizonyítékok támasztják alá a cikkben. A szövegbányászati ​​eredmények iPTMnetbe való integrálásához a PubTator-t (25) használjuk, amely lekéri a fehérje-/génemlítésekhez kapcsolódó NCBI-génazonosítókat.

        PTM információk a kurátor adatbázisokból

        Az iPTMnet számos szakértői kurátorból származó PTM-információkat integrál számos szervezet alacsony és nagy áteresztőképességű adataira is: (i) PhosphoSitePlus (PSP): szakértői kurátusú PTM-információk, beleértve a foszforilezést, ubikvitinációt, acetilezést és metilezést, főként emberi, patkány- és egérfehérjék (6) (ii) Phospho.ELM: szakértői kurátor adatbázis állati fehérjék foszforilezési helyeihez (11) (iii) PhosPhAt: tömegspektrometriával azonosított fehérje -foszforilációs helyek Arabidopsis thaliana (iv) PhosphoGrid: kísérletileg igazolt in vivo fehérje foszforilációs helyek Saccharomyces cerevisiae (26) v) PomBase: a hasadó élesztő átfogó adatbázisa Schizosaccharomyces pombe, amely szerkezeti és funkcionális annotációt, szakirodalmi kurálást és nagyméretű adatkészletekhez való hozzáférést biztosít (17) (vi) UniProtKB: átfogó fehérjeadatbázis, amelyben az áttekintett rész szakértői megjegyzésekkel ellátott szakirodalmi információkat tartalmaz, beleértve a PTM-szekvencia jellemzőit (27) (vii ) P3DB: több növényből származó fehérjefoszforilációs adatok, amelyek nagyszabású kísérletekből és az irodalomból származnak (14) (viii) neXtProt: humán fehérje tudásbázis (16) kurált proteomikai és genetikai variációs adatokkal, különösen a kinázokkal kapcsolatban ix) HPRD: PTM-ek és enzim-szubsztrát kapcsolatok humán fehérjékhez (28) (x) Signor: a biológiai entitások közötti ok-okozati összefüggések adatbázisa, beleértve a PTM-enzim szubsztrát összefüggéseket (29) és (xi) dbSNO: a kísérletileg igazolt cisztein S-nitrozilációt integráló adatbázis több faj lelőhelyei (30). Ezen adatbázisok némelyike ​​már nem gyűjti aktívan az új dokumentumokat. Az iPTMnetbe való bevonásával megőrizhetjük és terjeszthetjük értékes hozzájárulásukat. Ezen adatok integritását fenntartjuk a webhelyek/sorozatok érvényességének ellenőrzésével és a visszavont cikkek megfigyelésével, hogy szükség esetén kijavítsuk vagy eltávolítsuk az információkat.

        Fehérjék és PTM proteoformák szervezése PRO segítségével

        A PRO az iPTMnet adatkészlet döntő részét képezi, mivel a PTM-hely információit a proteoformák kontextusába helyezi, azaz megmutatja az adott fehérjében megfigyelt PTM-ek kombinációját. A PTM -ek kísérletileg validált kombinációinak képviselete egyedülálló. A PRO egy hierarchikus reprezentációt használ (család → gén → szekvencia → módosítás), amely leírja egy fehérje kapcsolatát a szülő osztályával, valamint a gyermek izoformáival és proteoformáival. A PRO-hierarchia egy fehérje specifikus proteoformáját is összekapcsolja a taxonok között, ha a konzervált fehérje hasonló módosulását kísérletileg több szervezetben is megfigyelték. Ezen túlmenően a PRO bőséges, szakértők által gondozott PTM enzim-szubsztrát és PTM-függő PPI kapcsolatokat biztosít.

        Minden PRO -adatot külön adatbázisban tárolnak, amelynek csak egy részét használja fel az iPTMnet. Az egyes PRO -bejegyzések leíró információi, például név, definíció és címke, közvetlenül a PRO -adatbázisból származnak. A PTM, PPI és PRO hierarchikus kapcsolatok kibontása és újraformázása az iPTMnetbe történő importálás előtt a következőképpen történik: (i) Az organizmus-specifikus PTM proteoformák esetében (PRO kategória: organizmus-módosítás) kivonjuk a bizonyítékokat, hivatkozunk az UniProtKB AC és PTM oldalaira. a megfelelő PTM-típusokkal együtt (amelyeket PSI-MOD (31) vagy UniCarbKB (9) azonosító jelképez) a fogalom definíciójából. A PTM enzim információkat a PRO megjegyzés sorból nyerjük ki. (Ii) A proteoform-függő PPI információkat a PRO kommentárfájlból nyerjük ki. Az „IPI” bizonyítékkódú (a fizikai interakcióból származó) vagy a „fehérjekötődés” ága alá tartozó megjegyzéseket a dokumentált interakciós partnerrel vonják ki, és iii) kétféle hierarchikus összefüggést vonnak ki: is_a (szülő-gyermek kapcsolat) és intersection_of (általában proteoform összekapcsolására azzal a szervezettel, amelyben megtalálható).


        Vannak olyan online források, amelyek felsorolják a fordítás utáni módosításokat és azok molekulatömegét? - Biológia

        Mi az a PIRSF?
        A PIRSF fehérjeosztályozó rendszer egy olyan hálózat, amely a szupercsaládoktól az alcsaládokig több szekvencia-diverzitással rendelkezik, és amely tükrözi a teljes hosszúságú fehérjék és domének evolúciós kapcsolatát. Az elsődleges PIRSF osztályozási egység a homeomorf család, amelynek tagjai homológok (közös ősből fejlődtek ki) és homeomorfok (teljes hosszúságú szekvencia-hasonlóság és közös tartomány-architektúra). Az automatikusan generált fehérjefürtöket manuálisan kurátozzák a tagság, a tartományi architektúra, a szekvencia jellemzők megjegyzése, valamint adott biológiai funkciók és biokémiai tevékenységek érdekében.

        Mit jelent nekem a PIRSF?
        A PIRSF kurált fehérjecsaládokat kínál a funkcionális hely- és fehérjenevek szaporítására és szabványosítására vonatkozó szabályokkal, ezáltal javítva a fehérje azonosítás és a funkcionális következtetés érzékenységét. A fehérjeszekvencia keresése a PIRSF adatbázis alapján gyorsabb és pontosabb értékelést nyújt a funkciójáról, mint a BLAST keresés a nem kurzált fehérjeadatbázisból. Elkerüli a buktatókat, például a számos hibás megjegyzést, a fő fehérjefunkcióhoz képest másodlagos tartományon alapuló legjobb találatokat, hamis találatokat stb.

        IProClass adatbázis

        Mi az iProClass?
        Az iProClass összefoglaló leírást nyújt az UniProt szekvenciák fehérjecsaládjáról, funkciójáról és szerkezetéről, több mint 90 biológiai adatbázisra mutató linkekkel (lásd adatforrásokat). Az iProClass jelentéseket tartalmaz az összes UniProtKB fehérjéről és azokról a fehérjékről, amelyek kizárólag az UniParc adatbázisban találhatók.

        iProClass szövegkeresés
        Az összefoglaló jelentések megfelelő listájának lekérése szöveges karakterlánc vagy egyedi azonosító alapján (mező kiválasztása a legördülő menüből). Kattintson a "Keresés" gombra az eredmények lekéréséhez. A "Beviteli mező hozzáadása" gombra kattintva további beviteli mezőket nyithat meg lekérdezésében. További információkért lásd a Szöveges keresés súgóját.

        IProLINK Súgó

        • Bibliográfiai térképezés: egy adott fehérje bejegyzést leíró cikkek azonosítása irodalmi forrásokból (például PubMed)
        • Annotáció kinyerése: annotációtípusok kategorizálása és az adott annotációt leíró mondatok és/vagy kifejezések kinyerése, ill.
        • Adatbázis -válogatás: a kivont irodalmi információk átalakítása az adatbázis adatbázis -feliratozásává strukturált szintaxissal, szabályozott szókinccsel és bizonyíték -hozzárendeléssel.

        Bibliográfia térképezése
        A fehérjebejegyzések összekapcsolása a vonatkozó tudományos szakirodalommal, amely leírja vagy jellemzi a fehérjéket, döntő fontosságú a kísérletileg ellenőrzött adatok mennyiségének növelése és a fehérje -megjegyzések minőségének javítása érdekében.
        Írjon be egy szöveges karakterláncot vagy egyedi azonosítót a lekérdezéshez kapcsolódó bibliográfia lekéréséhez.
        Az eredmények az iProClass eredményoldalához hasonló táblázatban jelennek meg, de az irodalomjegyzék lekéréséhez kapcsolódó speciális oszlopokkal. A bibliográfiai rekordra mutató hivatkozások, valamint az egyes PubMed bejegyzések elérhetők.
        iProLINK Bibliográfiai térképezési eredményoldal a UniProtKB P13866-hoz

        Feature Evidence Attribution
        A PIR-PSD adatbázisban a funkciók megjegyzéseit, például a kötési helyeket, a katalitikus helyeket és a módosított helyeket állapotcímkék jelzik "kísérleti"vagy"megjósolta"hogy megkülönböztessük a kísérletileg ellenőrzött és a számításilag előrejelzett adatokat. A bibliográfiai adatok megfelelő hozzárendeléséhez a kísérleti bizonyítékokkal rendelkező elemekhez retrospektív irodalmi felmérést végeztünk, amely magában foglalja az idézetek leképezését (az adott kísérleti jellemzőt leíró hivatkozások hivatkozásainak megkeresése a hivatkozásból) és a bizonyítékok címkézését is (Kísérleti bizonyítékot nyújtó mondatok megcímkézése egy absztrakt és/vagy teljes szövegű cikkben). Most ezt kiterjesztik az UniProtKB fehérjékre. Keressen olyan fehérjéket, amelyek meghatározott jellemzőkkel rendelkeznek, például poszttranszlációs módosítások, vagy írjon be egy UniProtKB azonosítót a lekéréshez funkciók hozzárendelése a lekérdezéshez. Később a "Bibliográfia" gombra kattintva a bejegyzéshez kapcsolódó kurátor bibliográfiát vagy a "Címkézett bizonyítékok" gombra kattintva minden elérhető címkézett bizonyítékot kaphat

        Funkció Példa
        Aktív oldalser
        Kötési helyheme
        Hasítási helyérvelni
        Cross-linkcys
        Diszulfid kötésekösszes
        Módosított webhelyBlokk*
        Tartományjelsorozat
        Termékdermorfin
        VidékATP kötődés


        iProLINK Funkcióleképezési eredményoldal a heme -kötő webhelyhez

        Az RLIMS-P egy szabályalapú szövegbányászati ​​program, amelyet kifejezetten a protein-kinázra, a szubsztrátra és a foszforilációs helyekre vonatkozó fehérje-foszforilációs információk kinyerésére fejlesztettek ki (Hu et al., 2005). A PMID -k bemenetként történő beküldésekor egy összesítő táblázatot ad vissza az összes PMID -ről a teljes jelentésekre mutató linkekkel. Az összefoglaló táblázat felsorolja az egyes foszforilációval kapcsolatos kivonatok PMID-jét, valamint a legmagasabb rangú kommentálási eredményét, majd a fennmaradó PMID-k listáját az absztraktokhoz, amelyek nem tartalmaznak foszforilációs információkat. A teljes jelentések lekérhetők az összefoglaló táblázatból hipertext hivatkozások segítségével (a „szöveges bizonyítékból”), vagy egy vagy több PMID kiválasztásával a listában.

        Összefoglaló táblázat a 2108025, 16436437, 15193450 PMID -khez

        A teljes RLIMS-P jelentés öt részből áll (lásd az alábbi táblázatot): 1- PubMed hivatkozási információk (megjelenés dátuma, szerzők, folyóirat) 2- PMID -leképezés az UniProtKB -hez, amely a leképezett bejegyzés csatlakozásából, azonosítójából, fehérje nevéből, szervezetéből és fehérjecsaládjából áll, linkekkel az UniProtKB és az iProClass (Wu et al., 2004) fehérjejelentésekhez, amelyek gazdag biológiai és funkcionális információkat tartalmaznak 3- Névleképezés az UniProtKB-re, beleértve a nevek használatának lehetőségeit az absztrakt vagy a felhasználó által megadott nevekben az online BioThesaurus kereséshez 4- Annotáció az RLIMS-P extrakciós eredmények rangsorolt ​​listájával a három foszforilációs objektum mindegyik halmazához és 5- Szöveges bizonyítékok, amelyek az eredeti kivonatot és címet mutatják be, kivont tárgyakkal, különböző színekkel megjelölve, hogy megkülönböztessük a protein -kinázokat, a foszforilált fehérjéket és a foszforilezett maradékokat/pozíciókat. Lehetőség van a színcímkézés ki- és bekapcsolására az absztrakt minden típusú objektumánál vizuális ellenőrzés céljából.

        Teljes jelentés a PMID 2108025-ről

        Entitásfelismerés/Ontológiafejlesztés
        A fehérje nevű entitásfelismerés (fehérje nevek megtalálása irodalmi szövegekből) előfeltétele a bibliográfiai feltérképezésnek (meghatározott fehérjéket leíró dokumentumok azonosítása). Ez alapvető fontosságú számos más biológiai irodalmi bányászati ​​feladathoz is, beleértve a fehérje-annotációk (például a fehérje-fehérje kölcsönhatások) kinyerését az irodalomból.

        -BioThesaurus
        A BioThesaurus egy webalapú rendszer, amelynek célja a fehérje- és génnevek átfogó gyűjteményének leképezése az UniProtKB fehérjebejegyzésekhez. A jelenleg több mint kétmillió fehérjét lefedő BioThesaurus több mint 2,6 millió névből áll, amelyek több online forrásból származnak az iProClass adatbázis-hivatkozásai alapján. Lehetővé teszi adott fehérjebejegyzések szinonim neveinek visszakeresését és a több fehérje által megosztott kétértelmű nevek azonosítását.
        Kereshet egy gén/fehérje nevének beírásával, vagy egy azonosító használatával.

        BioThesaurus jelentés az UniProtKB P18688 számára

        • Biomedicinos kifejezések (bt): Ezeket a kifejezéseket a biológiai és orvosi tudományok széles körében használják. Főleg az élet minden formájának szerkezetét írják le különböző szinteken (a durva morfológiától a molekuláris szerkezetig), valamint ezek funkcióit és mechanizmusait normál (fiziológiás) és beteg állapotokban (patológiás) egyaránt.
        • Kémiai kifejezések (ct): Ezek a szavak szerves vagy szervetlen kémiai anyagokat, kémiai csoportokat vagy kötéseket vagy kémiai tulajdonságokat írnak le.
        • Makromolekulák (mc): Ezek a szavak olyan biopolimerekre utalnak, mint a fehérjék, peptidek, DNS, RNS, poliszacharidok vagy glikoproteinek.
        • Közönséges angol (ce): A gyakori angol szavak a fehérjék különböző aspektusainak vagy tulajdonságainak leírására szolgálnak, mint pl rövid, jelző, kölcsönhatásba lépő, és javítás. Ide tartoznak a görög betűk helyesírási formái, valamint az olyan stop szavak is, mint a ,, és nak nek.
        • Nem szó tokenek: betűk, számok vagy szimbólumok kombinációi. Ezek gyakran rövidítések, szinonimák vagy rövidítések. A nem szó tokenek formája lehet csak szám, egy betű, több betű, vagy számok, betűk és egyéb szimbólumok kombinációja. A nem szóból álló jelzők biokémiai entitásokra, például nukleinsavakra, nukleotidokra és aminosavakra vonatkozhatnak, amelyeket egy fehérje névben lehet használni.

        -A fehérjék névcímkézési irányelvei és a névvel jelölt korpuszok
        A megnevezett entitásfelismerésre szolgáló egyéb iProLINK adatforrások két irodalmi korpuszhalmaz, amelyeket manuálisan címkéztek fehérjenevekkel a címkézési irányelvek két változata alapján. Az 1.0-s irányelv meghatározza, hogyan kell fehérjeobjektumokat címkézni, nem fehérje nevű entitásokat, míg a 2.0-s útmutató a fehérje nevű entitásokhoz határozza meg a címkézési szabályokat, függetlenül az objektum kontextusától.

        -PIRSF család osztályozáson alapuló fehérje ontológia
        A biológiai ontológiák kulcsfontosságúak a biológiai ismeretek kezelésében, ideértve a szakirodalmi adatok bányászatát a releváns információk kinyeréséhez és az információk több adatbázisból történő integrálásához. A fehérje ontológia, amely a fehérjeosztályok neveiből és szinonimáiból, valamint azok kapcsolataiból áll, segíthet a fehérje nevű entitás felismerésében. Továbbá egy fehérjecsalád -kapcsolatokon alapuló ontológia, például a PIRSF osztályozási rendszer a Gén Ontológiához (GO) társítható és kiegészíthető. Fejlesztettünk egy fehérje ontológiát a PIRSF hierarchikus családnevek alapján. Az ontológia GO lapos fájlformátumban van, DAG (irányított aciklikus gráf) struktúrával, és böngészhető olyan alkalmazási eszközökkel, mint a DAG-Edit.

        Szöveges keresési súgó

        Válasszon egy adatbázist
        Attól függően, hogy a Szövegkeresés oldalhoz milyen módon jutott el, előfordulhat, hogy választania kell az iProClass adatbázis között, amely UniProtKB -t és egyedi UniParc fehérjéket tartalmaz, és a PIRSF adatbázis között, amely a PIRSF családok teljes készletét tartalmazza (azaz bármely kurátorszintet) . A kezdőlapon és a gyorskeresőmezőben található szöveges keresés azonban az iProClass adatbázist használja.
        A kimeneti fájl egy táblázatot jelenít meg az egyes fehérjebejegyzésekkel vagy fehérjecsaládokkal, iProClass vagy PIRSF esetén.

        Mező kiválasztása
        A kereshető mezők a legördülő menüből választhatók ki. Az elemek a kiválasztott adatbázistól függően változnak, mivel minden adatbázis különböző típusú információkat tartalmaz.

        Lekérdezési bemenet
        Írjon be egy egyedi azonosítót vagy más keresési karakterláncot a megadott mezőbe.
        Bizonyos elemek (például a „Hossz” vagy az „ID” jelzésűek) pontos egyezésű keresések lesznek. A többi elem allánc keresés lesz (mintha előtte és után karakterek lennének).
        Ha a mező opció meg van jelenítve, a "nem null" beírása a szövegmezőbe azt eredményezi, hogy a keresés csak azokat a bejegyzéseket adja vissza, amelyek bizonyos adatokat tartalmaznak a kiválasztott mezőben, míg a "null" megadása csak azokat adja vissza, amelyekben nincs adat a kiválasztott mezőben .
        A peptidkereséshez írjon be egy aminosavmaradék -sorozatot egybetűs kóddal (legalább három betű), majd nyomja meg a nyilat a találatok lekéréséhez.

        Beviteli doboz hozzáadása gomb
        Kívánt esetben több mező is kereshető egyszerre. A "+ doboz" gomb megnyomása újabb lekérdezési sort ad hozzá, legfeljebb 8 sorig. A hozzáadott beviteli mezőket logikai operátorválasztások kötik össze (lásd alább), az alapértelmezett az Add operátor.

        A logikai operátorok használata AND, OR, NOT
        A keresés támogatja a logikai „ÉS”, „VAGY” és „NEM” operátorokat. Például, ha olyan eredményeket szeretne lekérni, amelyek tartalmazzák az A vagy B Pfam tartományt, írja be az A kifejezést az első lekérdezési mezőbe, és adjon hozzá egy lekérdezési sort a "Beviteli mező hozzáadása" gombra kattintva. Írja be a 2. lekérdezést (B), és válassza ki a VAGY operátort. Hasonlóképpen, ha több doménből álló fehérjéket szeretne lekérni, amelyeknek Pfam A és B doménje is van, használja az „AND” operátort. Az A és nem B doménnel rendelkező fehérjéket a „NOT” operátor segítségével lehet lekérni.

        Eredmények száma
        A leggyorsabb eredmény elérése érdekében az egyes oldalakon megjelenő bejegyzések alapértelmezett száma 50.

        Keresési kategóriák és egyedi azonosítók
        A következő táblázat a Szöveg és a Kötegelt lekérés funkciók kereshető mezőit mutatja. A kereshető mezők a legördülő menüből választhatók ki. Az adatbázisokban egyedi azonosítók vagy kulcsszavak segítségével kereshet. A belépési példákat az alábbiakban mutatjuk be.

        FŐ KATEGÓRIA ALKATEGÓRIA TARTALMAZÓ MEZŐK PÉLDÁ(K) i ProClass PIRSF
        SorrendUniProt azonosítókUniProtKB azonosító/ACIMDH2_HUMAN/P12268
        UniRef100UniRef100_P12268
        UniParcUPI00004C7276
        PIR szekvenciaazonosítókPIR-PSD azonosító/váltóA31997/I52303
        Egyéb szekvenciaazonosítók
        FlyBase azonosítóFBgn0002940
        GenBank ACJ04208
        GenPept ACAAH12840.1
        NCBI GI szám15277480
        IPI azonosítóIPI00291510
        MGI azonosító95561
        RefSeq ACNM_000875
        SGD azonosítóS000001047
        TIGR azonosítóSAG1156
        Gén/fehérje neveGén neveIMPDH2
        Fehérje neveIMP dehidrogenáz
        OsztályozásOsztályazonosítók
        BLOCKS IDIPB000644
        COG azonosítóCOG1009
        Pfam azonosító/névPF00478
        IMP dehidrogenáz
        PIRSF azonosító/névPIRSF000130
        inozin-5'-monofoszfát-dehidrogenáz
        NYOMTATÁSI IDPR01434
        PROSITE azonosítóPS00487
        SCOP szupercsaládnévInozin-monofoszfát-dehidrogenáz
        UniRef50 azonosítóUniRef50_P20839
        UniRef90 azonosítóUniRef90_P12268
        PIRSFÁtlagos hosszúság500 (aminosavak)
        Kurátori állapotTeljes
        PIRSF tagságPIRSF000186:F
        PIRSF szintHFam
        Rep. Seq.P12268
        FunkcióKomplex/kölcsönhatásokBIND azonosító93185
        Gén ontológiaGO azonosító0003938
        Pathway KEGG útvonal/azonosítóPurin anyagcsere
        hsa00230
        EnzimEK szám/névEC 1.1.1.205/ Oxidoreduktázok
        FunkcióRESID azonosítóAA0005
        Minden funkciómezőL-cisztein
        SzervezetTaxonómiaTaxon
        Csoport/Csoportazonosító
        Euk / Emlős / 40674
        Taxon azonosító9606
        Faj/vonalLeszármazásEukarióta
        Szervezet neveHomo sapiens
        Gyakori névEmberi
        IrodalomPubMed azonosítóPubMed azonosító10097070
        Szerző neveSzerző neveHuberman
        Folyóirat neveFolyóirat neveBiochem Biophys Res Commun.
        Papír címePapír címeA humán II típusú IMP klónozása és szekvenciája
        Vegyes 3D szerkezetPDB azonosító1B3O
        IngatlanHossz514 (aminosavak)
        Molekuláris tömeg55804 (Daltons)
        KulcsszóKulcsszóNAD
        Genetikai variáció/betegségOMIM azonosító146691
        Genom Entrez génazonosító3615

        Szöveges keresési eredmények súgója

        Ez a szakasz az iProClass és a PIRSF szövegkeresési eredményoldalát írja le. Az oldal általános elrendezése mindkettőhöz hasonló, azonban eltér a megjelenített alapértelmezett oszlopokban, valamint az adatok elemzésére rendelkezésre álló eszközökben. Először a közös jellemzőket írjuk le 1-3, ahol a számok azt a helyet jelzik, ahol ezeket a funkciókat megtalálhatja az oldalon (lásd alább az iProClass és a PIRSF eredményoldalakat).

        2- Kijelző opciók
        Az egyedi igényektől függően kiválaszthatja a megjelenítendő oszlopokat. Ehhez kattintson a „Megjelenítési opció” gombra, válassza ki a megfelelő mező (ke) t a „Mezők nem jelennek meg” listában, és vigye át a „Megjelenített mezők” listába a > "gombot. Ezzel szemben az oszlopok eltávolíthatók a kijelzőről. Végül kattintson az" Alkalmaz "gombra, hogy a módosítások életbe lépjenek.

        3- Eredmények mentése másként
        A kimenet a felhasználó helyi számítógépére menthető. Az eredmények mentésre kerülnek a kiválasztott bejegyzéseknél, vagy ha nincs fehérje kiválasztva, akkor az összes bejegyzésnél. A "Táblázat" gombra kattintva a megjelenített oszlopok tabulátorral elválasztott szövegfájlként kerülnek mentésre, amelyet a táblázatba lehet importálni a könnyebb megtekintés vagy elemzés érdekében. A „FASTA” gombra kattintva az azonosítók és sorozatok FASTA formátumban menthetők.

        5- Eredmények megjelenítése
        A keresés eredményei egy testreszabható táblázatban jelennek meg. A megjelenített pontos oszlopok a keresett mezőktől és a felhasználói preferenciáktól függenek.

        Fehérje AC/ID
        A fehérje AC/ID az UniProtKB vagy UniParc azonosítókra utal. E számok alatt választhatja a fehérjejelentés iProClass vagy UniProtKB/UniParc nézetét. Az UniProtKB szekvencia forrása UniProtKB/Swiss-Prot vagy UniProtKB/TrEMBL néven jelenik meg, ha a fehérje szekvencia a Swiss-Prot vagy a TrEMBL szakaszból származik. Alternatív megoldásként az UniParc azonosító jelenik meg, ha a sorozat nincs jelen az UniProtKB adatbázisban az UniParc jelentéssel együtt.

        Fehérje neve
        A fehérje általános neve, amely azonosítja a funkcióját vagy meghatározza annak jellemzőit.

        Hossz
        A peptidben vagy fehérjében található aminosavmaradékok száma.

        Szervezet neve
        A forrásszervezet nemzetsége és faja, amelyből a szekvencia származik. Hivatkozások találhatók az NCBI rendszertani információkra.

        PIRSF azonosító
        Ha egy fehérje PIRSF családhoz tartozik, akkor ez az oszlop a megfelelő családazonosítót fogja megjeleníteni. Kattintson az azonosítóra a PIRSF jelentés letöltéséhez (lásd a megjegyzésekkel ellátott kimenetet).

        Kapcsolódó sz.
        Ez az oszlop az alapértelmezett paraméterekkel kapott előre kiszámított BLAST-találatok számát mutatja. Csak legfeljebb 300 sorozat jelenik meg. A számra kattintva elérheti a kapcsolódó sorozatlapot. Ez lehetővé teszi a sorozatok hasonlóságának nagyon gyors pillantását. Maga a szám már ad némi információt arról, hogy mennyire egyedi a fehérje. Például egy nagyon alacsony szám azt jelezheti, hogy a lekérdezés egy bizonyos fajra, nemzetségre, taxonra stb. Vonatkozik. A Kapcsolódó sorozat címe melletti " +" jel lehetővé teszi a kapcsolódó szekvenciák számának összehasonlítását 3 különböző E-értéknél határértékek az alábbiak szerint.

        Egyező mezők
        A lekérdezésnek megfelelő mező(k).

        6- GO Slim
        A GO karcsúságok a Gene Ontologies kisebb változatai, amelyek a GO egészében található kifejezések egy részhalmazát tartalmazzák. Széles körű áttekintést adnak az ontológia tartalmáról, a konkrét finom szempontok részletezése nélkül. A GO karcsúságok különösen hasznosak egy genom vagy proteóm GO annotációjának eredményeinek összefoglalásához, ha a géntermék funkcióinak széles körű osztályozása szükséges.

        Megtekintheti a GO slim feltételeket a biológiai funkciókra, összetevőkre és folyamatokra vonatkozóan, ha az elemző eszköztár „Show GO Slim” gombját választja. A. Ezután megtekintheti az egyes ontológiák (függvény, komponens és függvény) statisztikáit úgy, hogy ellenőrzi az érdekes bejegyzéseket, és kiválasztja a megjeleníteni kívánt ontológiát (például ebben a példában a függvényt, A). Kövesse a GO ID hivatkozásokat, ha többet szeretne megtudni a GO kifejezésről. Ezenkívül megtekintheti az ontológián belüli kifejezéseket a GO grafikus hierarchikus nézet ikonjának kiválasztásával (B). A grafikus kijelzőn megjelenik a GO hierarchia a táblázatban szereplő kifejezésekhez viszonyítva C). Az adott fehérjét leképező kifejezések színesben jelennek meg, a zárójelben lévő szám azt jelzi, hogy hány fehérje van a kiválasztott készletben, amelyekhez az adott kifejezés kapcsolódik. A számra kattintva lekérjük a megfelelő fehérje bejegyzéseket. Lehetőség van a grafikon svg formátumban történő megjelenítésére. Ez a formátum lehetővé teszi a kép átméretezését.

        Ha egynél több PIRSF van kiválasztva, egy felugró üzenet jelzi, hogy az egyes családok reprezentatív szekvenciáit fogják használni az igazításhoz.

        5- Eredmények megjelenítése
        A keresés eredményei egy testreszabható táblázatban jelennek meg. A megjelenített pontos oszlopok a keresett mezőktől és a felhasználói preferenciáktól függenek.

        PIRSF azonosító
        Ebben az oszlopban megjelenik a megfelelő családazonosító. Kattintson az azonosítóra a PIRSF jelentés lekéréséhez. A PIRSF azonosító alatti ikon a család szintjét jelzi, nevezetesen a homeomorf családot (H Fam), alcsaládot (Sub Fam) és szupercsaládot (Super Fam). Erre az ikonra kattintva a PIRSF Hierarchia DAG nézete jelenik meg, a PFam tartomány pedig magasabb szinten.

        PIRSF név
        A PIRSF név a teljes körűen kurátált családok számára fontos, mivel ezeket a neveket egy kurátor elemezte. A PIRSF név célja a család tagjainak néhány közös jellemzőjének vagy funkciójának leírása. Amikor csak lehetséges, a PIRSF nevek irodalomon alapulnak, és próbálják követni a közzétett szabványokat. A legtöbb esetben a nevekhez zárójelben van egy bizonyítékcímke vagy névstátusz, amely biztosítja a hozzárendelt név megbízhatósági szintjét. A lehetséges PIRSF névstátusz címkék a következők: validált (vannak kísérleti adatok, amelyek alátámasztják a PIRSF nevet), kísérleti (nincs meggyőző kísérleti bizonyíték) vagy előrejelzett (számítási módszerekkel előrejelzett).

        Sz. sz.
        A sorozatok száma a családban.

        Átl.hossz
        Ez a PIRSF tagjainak átlagos fehérjehossza.

        Domain architektúra
        Ez a fehérjecsalád jelenlegi Pfam doménjeire vonatkozó kurátor információkat tartalmazza. A Pfam tartományok sorrendben vannak felsorolva az N- és a C-terminális között, pontosvesszővel elválasztva. Néhány esetben a tartományokat kötőjel választja el egymástól, jelezve a beszúrt tartományok jelenlétét. A zárójelben lévő számok a tartomány ismétlődését jelzik. Ennek a funkciónak külön szintaxisa van. Például a PF11111 (1-3) a PF11111 1-3 példányát teszi lehetővé, míg a PF11111 (2-) az 1 (2 vagy több) feletti tartományokat. A PF11111 (0,2) azonban nem engedélyezi ennek a tartománynak egy vagy két másolatát.

        Felügyeleti állapot
        Nem kuratált: Számítógéppel generált fehérjeklaszterek, nem kuráltak.
        Előzetes: A fehérjecsaládok tagsága és domain -architektúrája manuális kurátorral meghatározott.
        Teljes: Fehérje családnév kísérő hivatkozásokkal (ha rendelkezésre állnak), és néha rövid leírásokkal, alapos kézi kurátor után.

        Egyező mezők
        A lekérdezésnek megfelelő mező (k).

        Batch Retrieval Help

        Több bejegyzés letöltése egy adott azonosító vagy az azonosítók kombinációjának kiválasztásával.

        Válassza ki az adatbázist
        A fehérjeazonosítók megadása előtt ki kell választania a legkényelmesebb adatbázist. Ha információkat szeretne lekérni a fehérjecsaládokról, válassza ki a PIRSF adatbázist, ha azonban egyedi fehérjék elemzése érdekli, válassza az iProClass adatbázist.

        Az azonosítók megadásának szabályai
        A több bejegyzés azonosítóját sorokkal vagy szóközzel kell elválasztani.
        Az azonosítók megadhatók egyetlen kategóriaként vagy vegyes kategóriaként. Ha azonban a bejegyzések azonos típusú azonosítóval rendelkeznek, ajánlott az azonosító mező meghatározása a lekérdezési folyamat felgyorsítása érdekében.


        A letöltött eredményeket és/vagy azok sorozatát tovább elemezheti és mentheti, hasonlóan, mint a szövegkeresés után. Kattintson a "Match List" gombra, hogy ellenőrizze a bejegyzés azonosítói és a kiválasztott adatbázis azonosítói közötti megfelelést.

        Kötegelt visszakeresési kimenet az iProClass adatbázisban

        1169968, 1707983 és 304131 GI számú sorozatok lekérése

        1- Eladó doboz
        Ez a mező mutatja a lekérdezési azonosítóját, és lehetővé teszi új lekérdezés végrehajtását is.

        2- Kijelző opciók
        Az egyedi igényektől függően kiválaszthatja a megjelenítendő oszlopokat. Ehhez kattintson a „Megjelenítési opció” gombra, válassza ki a megfelelő mező (ke) t a „Mezők nem jelennek meg” listában, és vigye át a „Megjelenített mezők” listába a > "gombot. Ezzel szemben az oszlopok eltávolíthatók a kijelzőről. Végül kattintson az" Alkalmaz "gombra, hogy a módosítások életbe lépjenek.

        3- Eredmények mentése más néven
        A kimenet a felhasználó helyi számítógépére menthető. Az eredmények mentésre kerülnek a kiválasztott bejegyzéseknél, vagy ha nincs fehérje kiválasztva, akkor az összes bejegyzésnél. A "Táblázat" gombra kattintva a megjelenített oszlopokat tabulátorral tagolt szövegfájlként menti, amelyet táblázatba importálhat a könnyebb megtekintés vagy elemzés érdekében. A "FASTA" gombra kattintva az azonosítók és sorozatok FASTA formátumban kerülnek mentésre.

        5- Eredmények megjelenítése
        A keresés eredményei táblázatban jelennek meg.

        Fehérje AC/ID
        A fehérje AC/ID az UniProtKB csatlakozási számra és azonosítóra vonatkozik. Ezek alatt választhatja az egyes fehérjejelentések iProClass vagy UniProtKB/UniParc nézetét.Az UniProtKB szekvencia forrása UniProtKB/SP vagy UniProtKB/Tr néven jelenik meg, ha a fehérje szekvencia Swiss-Prot vagy TrEMBL.

        Fehérje neve
        A fehérje általános neve, amely azonosítja a funkcióját vagy meghatározza annak jellemzőit.

        Hossz
        A peptidben vagy fehérjében található aminosavmaradékok száma.

        Szervezet neve
        A forrásszervezet nemzetsége és faja, amelyből a szekvencia származik. Hivatkozások találhatók az NCBI rendszertani információkra.

        PIRSF azonosító
        Ha egy fehérje PIRSF családhoz tartozik, akkor ez az oszlop a megfelelő családazonosítót fogja megjeleníteni. Kattintson az azonosítóra a PIRSF jelentés lekéréséhez.

        Match Range
        Ez az oszlop pirossal mutatja a szekvencián belüli peptidlekérdezést.

        6- GO Slim
        A GO karcsúságok a Gene Ontologies kisebb változatai, amelyek a GO egészében található kifejezések egy részhalmazát tartalmazzák. Széles körű áttekintést adnak az ontológia tartalmáról, a konkrét finom szempontok részletezése nélkül. A GO karcsúságok különösen hasznosak egy genom vagy proteóm GO annotációjának eredményeinek összefoglalásához, ha a géntermék funkcióinak széles körű osztályozása szükséges.

        Megtekintheti a GO slim feltételeket a biológiai funkciókra, összetevőkre és folyamatokra az elemző eszköztár „Show GO Slim” gombjának kiválasztásával. Ezután megtekintheti az egyes ontológiák (Funkció, Komponens és Funkció) statisztikáit, ha ellenőrzi az érdeklődő bejegyzéseket, és kiválasztja a megjelenítendő ontológiát (például ebben a példában a funkciót). Kövesse a GO ID hivatkozásokat, ha többet szeretne megtudni a GO kifejezésről.

        7- A találati lista megjelenítése
        Megmutatja a lekérdezési azonosítóit az UniProtKB/UniParc azonosítókkal feltérképező táblázatot.

        Kötegelt visszakeresési kimenet a PIRSF adatbázisban

        PIRSF-ek lekérdezése UniProtKB ACs P51375, P09831 és Q05755 lekérdezés használatával

        1- Eladó doboz
        Ez a mező mutatja a lekérdezési azonosítót, és lehetővé teszi új lekérdezés végrehajtását is

        2- Kijelző opciók
        Az egyedi igényektől függően kiválaszthatja a megjelenítendő oszlopokat. Ehhez kattintson a „Megjelenítési opció” gombra, válassza ki a megfelelő mező (ke) t a „Mezők nem jelennek meg” listában, és vigye át a „Megjelenített mezők” listába a > "gombot. Ezzel szemben az oszlopok eltávolíthatók a kijelzőről. Végül kattintson az" Alkalmaz "gombra, hogy a módosítások életbe lépjenek.

        3- Eredmények mentése más néven
        A kimenet a felhasználó helyi számítógépére menthető. Az eredmények mentésre kerülnek a kiválasztott bejegyzéseknél, vagy ha nincs fehérje kiválasztva, akkor az összes bejegyzésnél. A "Táblázat" gombra kattintva a megjelenített oszlopokat tabulátorral tagolt szövegfájlként menti, amelyet táblázatba importálhat a könnyebb megtekintés vagy elemzés érdekében. A "FASTA" gombra kattintva az azonosítók és sorozatok FASTA formátumban kerülnek mentésre.

        5- Eredmények megjelenítése
        A keresés eredményei táblázatban jelennek meg.

        PIRSF azonosító
        Ebben az oszlopban megjelenik a megfelelő családazonosító. Kattintson az azonosítóra a PIRSF jelentés lekéréséhez. A PIRSF azonosító alatti ikon a család szintjét jelzi, nevezetesen a homeomorf családot (H Fam), alcsaládot (Sub Fam) és szupercsaládot (Super Fam). Erre az ikonra kattintva a PIRSF Hierarchia DAG nézete jelenik meg, a PFam tartomány pedig magasabb szinten.

        PIRSF név
        A családnak adott név, amely azonosítja a funkcióját vagy meghatározza annak jellemzőit. A kurátor állapotától függően ez a név automatikusan (nincs kézi kurátor) vagy manuálisan (teljes kurátor) van hozzárendelve. Ha a családot gondozzák, akkor a név mellett egy címkét jeleníthet meg, amely jelzi annak állapotát, nevezetesen validált (vannak kísérleti adatok, amelyek alátámasztják a PIRSF nevet), kísérleti (nincs meggyőző bizonyíték) vagy előrejelzett (számítási módszerekkel előrejelzett).

        Hossz
        Ez a PIRSF tagok átlagos fehérjehossza.

        Domain architektúra
        Ez a fehérjecsalád jelenlegi Pfam doménjeire vonatkozó kurátor információkat tartalmazza. A Pfam tartományok sorrendben vannak felsorolva az N- és a C-terminális között, pontosvesszővel elválasztva. Néhány esetben a tartományokat kötőjel választja el egymástól, jelezve a beszúrt tartományok jelenlétét. A zárójelben lévő számok a tartomány ismétlődését jelzik. Ennek a funkciónak külön szintaxisa van. Például a PF11111 (1-3) a PF11111 1-3 példányát teszi lehetővé, míg a PF11111 (2-) az 1 (2 vagy több) feletti tartományokat. A PF11111 (0,2) azonban nem engedélyezi ennek a tartománynak egy vagy két másolatát.

        Felügyeleti állapot
        Nem kuratált: Számítógéppel generált fehérjeklaszterek, nem kuráltak.
        Előzetes: A fehérjecsaládok tagsága és domain -architektúrája manuális kurátorral meghatározott.
        Teljes: Fehérje családnév kísérő hivatkozásokkal (ha rendelkezésre állnak), és néha rövid leírásokkal, alapos kézi kurátor után.

        Egyező mezők
        A lekérdezésnek megfelelő mező (k).

        6- A találati lista megjelenítése
        Táblázatot jelenít meg, amely lekérdezési azonosítóit a megfelelő PIRSF -hez társítja.

        BLAST Search Help

        .
        2. BLAST keresési formátum
        A BLAST "Keresés" beviteli területe elfogadja:

        BLAST opciók
        A BLAST a BLOSUM62 mátrix használatával történik, a résnyitás és a bővítési költség alapértelmezett értékeivel. Azonban a következő paraméterek állíthatók be:

        -Összetétel-alapú statisztika
        A BLAST lehetővé teszi, hogy a számított E-értékek figyelembe vegyék az egyes adatbázis-szekvenciák aminosav-összetételét, amelyek részt vesznek a jelentett igazításokban. Ez javítja az E-érték pontosságát, ezáltal csökkenti a hamis pozitív eredmények számát. A továbbfejlesztett statisztika egy skálázási eljárással érhető el, amely gyakorlatilag minden adatbázis-szekvenciához kissé eltérő pontozási rendszert alkalmaz. Ennek eredményeként a nyers BLAST igazítási pontszámok általában nem fognak pontosan megfelelni azoknak, amelyeket bármely standard helyettesítési mátrix feltételez. Ezenkívül az azonos illesztések különböző pontszámokat kaphatnak az általuk érintett szekvenciák összetétele alapján.

          Alacsony komplexitás
          Elfedi a lekérdezési sorozat szegmenseit, amelyek összetétele alacsony, a Wootton és Federhen SEG programja szerint (Computers and Chemistry, 1993). A szűrés kiküszöbölheti a statisztikailag szignifikáns, de biológiailag érdektelen jelentéseket a BLAST kimenetből (pl. A gyakori savas, bázikus vagy prolinban gazdag régiók elleni találatok), így a lekérdezési szekvencia biológiailag érdekesebb régiói elérhetők az adatbázis-szekvenciák specifikus egyezésére. A szűrés csak a lekérdezéssorozatra vonatkozik, az adatbázis -sorozatokra nem.
          Maszk csak keresőtáblázathoz
          Ez az opció csak a BLAST által használt keresési tábla létrehozásához takar. A BLAST keresések két fázisból állnak, találatokat keresnek egy keresési táblázat alapján, majd kiterjesztik azokat. A „Csak a keresési táblázat maszkolása” opció csak a keresési táblát takarja el, így a rendszer nem talál találatokat az alacsony bonyolultságú sorrend alapján. A BLAST kiterjesztéseket maszkolás nélkül hajtják végre, így kis komplexitású szekvenciával bővíthetők. Ez a lehetőség még kísérleti jellegű, és a közeljövőben változhat.
          Maszk kisbetű
          Ezzel az opcióval kivághat és beilleszthet egy FASTA sorozatot nagybetűkkel, és megjelölheti azokat a területeket, amelyeket kisbetűkkel szeretne szűrni. Ez lehetővé teszi a BLAST adatbázisokhoz való összehasonlítás során a szekvenciából szűrt személyre szabást.

        -Elvárás
        Az Expect küszöbérték statisztikai szignifikancia küszöbértéket hoz létre az adatbázis-szekvenciák egyezéseinek jelentéséhez. Az alapértelmezett érték 10, ami azt jelenti, hogy várhatóan 10 egyezést találunk csak véletlenül. Az alsó várakozási küszöbértékek szigorúbbak, ami kevesebb esélyes mérkőzés jelentését eredményezi. A várt küszöb növelése kevésbé szigorú egyezéseket mutat, és rövid sorozatokkal végzett kereséseknél javasolt, mivel egy rövid lekérdezés nagyobb valószínűséggel fordul elő véletlenül az adatbázisban, mint egy hosszabb, így még a tökéletes egyezés (nincs hiányosság) is alacsony statisztikai jelentőségű lehet. és nem lehet bejelenteni. A Várakozási küszöb növelése lehetővé teszi, hogy messzebbre nézzen a találati listában, és olyan egyezéseket láthat, amelyeket általában elvetnek az alacsony statisztikai szignifikancia miatt.

        -Szó mérete
        A szóméret a kezdeti sorozat hosszát jelzi, amelyet az adatbázis és a lekérdezési sorozat között egyeztetni kell.

        -Mátrix
        A páros szekvencia -illesztés minőségének értékelésében kulcsfontosságú elem a "szubsztitúciós mátrix", amely pontszámot rendel az esetleges maradékpárok összehangolásához. A BLAST keresésben használt mátrix megváltoztatható attól függően, hogy milyen szekvenciákkal keres. A felhasználó választhat a különböző evolúciós korlátokat lefedő mátrixok listájából (további információ a BLAST pontozási mátrixok leírásában található). Minden mátrix esetében megjelenik egy alapértelmezett mátrixfüggő résköltség. A hiányos költségeket az alábbiakban ismertetjük.

        -Mátrixfüggő résköltség
        A legördülő menüben láthatók a résköltségek (büntetés a rés megnyitásához és büntetés a rés növeléséhez). Ezekhez a paraméterekhez korlátozott számú lehetőség áll rendelkezésre. A hézagköltségek növelése olyan igazításokat eredményez, amelyek csökkentik a bevezetett hiányosságok számát. A rés nyitott büntetése a pontszám, amelyet a sorozatban lévő rés kezdeményezéséért vesznek el. Annak érdekében, hogy a mérkőzés jelentősebb legyen, a felhasználó megpróbálhatja növelni a rést. A réshosszabbítási büntetés hozzáadódik a résnyitott büntetéshez a résben lévő minden egyes maradék esetén, hatékonyan büntetve a hosszabb hézagokat. Ha a felhasználó nem szereti a hosszú réseket, akkor növelheti a hosszabbítási rést. Általában néhány rövid rést várunk, nem pedig sok rövid rést, ezért a résbővítési büntetésnek alacsonyabbnak kell lennie, mint a rés büntetésének. Kivételt képez az az eset, amikor az egyik vagy mindkét szekvencia egyetlen olvasás lehetséges szekvenálási hibákkal, ebben az esetben sok egyetlen bázis rést várhat. A felhasználó ezt az eredményt úgy érheti el, hogy a résnyitási büntetést nullára (vagy nagyon alacsonyra) állítja, és a rés-kiterjesztési büntetést használja a réspontozás szabályozására.

        -Állítsa be a hiányzó költségeket
        A szekvenciák közötti igazításokat gyakran úgy optimalizálják, hogy az egyik vagy mindkét szekvencián belül réseket engednek meg. Az illeszkedő maradékok közötti eltérésekhez hasonlóan a résekhez is "költség" kapcsolódik. Külön büntetés jár a hézagok megnyitására és kiterjesztésére. A hiányosságok növelése olyan igazításokat eredményez, amelyek csökkentik a bevezetett hiányosságok számát és méretét. A rés megnyitási költsége (vagy réslétezési költség) az a pontszám, amelyet levonnak a sorozatban lévő rés kezdetéért. A mérkőzés jelentőségének növelése érdekében a felhasználó megpróbálhatja növelni ezt a résbüntetést. A Gap Extend költséget hozzáadják a Gap Open költséghez a résen lévő minden egyes maradék esetében, hatékonyan büntetve a hosszabb réseket. A felhasználó tehát választhat a hosszú rések ellen, növelve ezt a büntetést. Általában néhány rövid hiányosságra lehet számítani, nem pedig sok rövidre, ezért a Gap Extend költségnek alacsonyabbnak kell lennie, mint a Gap Open költségnek. A hiányzó költségek a legördülő menü segítségével az alapértelmezett értékhez képest módosíthatók.

        -Megjelenítendő találatok száma
        Korlátozza a jelenteni kívánt egyező sorozatok BLAST -találatainak számát.

        -Igazítás
        Párba igazítja a lekérdezési sorrendet és az adatbázis-egyezéseket. A mérkőzések "|" karakterrel vannak összekötve szimbólum. Az eltérések szóközzel ellentétesek. A hiányosságok "-" szimbólummal vannak ellátva.

          Wootton JC és Federhen S (1993) A helyi komplexitás statisztikái aminosavszekvenciákban és szekvencia adatbázisokban. Számítógépek és Kémia 17:149-163.

        BLAST Results Help

        Az alábbiakban egy minta kimenet látható az UniProtKB adatbázisban végzett BLAST kereséshez

        1- Lekérdezési sorrend bekapcsolva
        Kattintson erre a gombra a lekérdezéssorozat megjelenítéséhez. Fordítva, kattintson újra, hogy elrejtse.

        2- Eredmények mentése másként
        A keresési eredmények menthetők a felhasználó helyi számítógépére. Az eredmények mentésre kerülnek a kiválasztott bejegyzéseknél, vagy ha nincs fehérje kiválasztva, akkor az összes bejegyzésnél. A "Táblázat" gombra kattintva a megjelenített oszlopokat tabulátorral tagolt szövegfájlként menti, amelyet táblázatba importálhat a könnyebb megtekintés vagy elemzés érdekében. A "FASTA" gombra kattintva az azonosítók és sorozatok FASTA formátumban kerülnek mentésre.

        Oszlopok rendezése
        Az oszlopok a megfelelő értékek szerint rendezhetők az oszlop címe melletti nyílra kattintva. A táblázat alapértelmezés szerint Pontszám szerint van rendezve.

        A keresés eredményei egy táblázatban jelennek meg a következő alapértelmezett oszlopokkal:

        Fehérje AC/ID
        A fehérje AC/ID az UniProtKB csatlakozási számra és az azonosítóra vonatkozik. Ezen azonosítók alatt választhatja a fehérjejelentés iProClass vagy UniProtKB nézetét. Az UniProtKB szekvencia forrása UniProtKB/Swiss-Prot vagy UniProtKB/TrEMBL, ha a fehérjeszekvencia az UniProtKB Swiss-Prot vagy TrEMBL szakaszából származik.

        Fehérje neve
        A fehérje általános neve, amely azonosítja a funkcióját vagy meghatározza annak jellemzőit.

        Hossz
        A peptidben vagy fehérjében található aminosavmaradékok száma.

        Szervezet neve
        A forrásszervezet nemzetsége és faja, amelyből a szekvencia származik. Hivatkozások találhatók az NCBI rendszertani információkra.

        PIRSF azonosító
        Ha egy fehérje PIRSF családhoz tartozik, akkor ez az oszlop a megfelelő családazonosítót fogja megjeleníteni. Kattintson az azonosítóra a PIRSF jelentés letöltéséhez (lásd a megjegyzésekkel ellátott kimenetet).

        BLAST szekvencia hasonlósági oszlopok
        Három oszlop kapcsolódik a BLAST eredményekhez. Az Igazítás oszlop a szélső jobb oldalon a BLAST eredményeket mutatja grafikus formában. A felső sáv a lekérdezési sorrendet jelöli. Az alábbi sávok a lekérdezési szekvenciához illeszkedő egyéb szekvenciák régiójait mutatják. A sáv színe a BLAST pontszám nagyságát jelzi. Kattintson a sávok egyikére a BLAST -illesztés és a lekérdezési sorrend párosításához.

        SSearch Oszlopok
        Az SSearch a Smith-Waterman igazítási algoritmus páros megvalósítása. Ha két sorozatot igazít, csak a megosztott régió jelenik meg. A megosztott régión belül az egyik vagy mindkét szekvenciából származó aminosavak egymáshoz illeszthetők a másik szekvencia aminosavaival vagy réseivel. A megosztott régió teljes hossza, beleértve a hiányosságokat, az Átfedés oszlopban látható. Az azonos maradékok százalékos aránya az igazításban %identif. A számra kattintva megjelenik az SSearch teljes hosszúságú igazítása.

        5- Nyers kimenet megjelenítése
        A jelentés három fő részből áll: (1) a fejléc, amely információkat tartalmaz a lekérdezéssorozatról, a keresett adatbázisról. (2) az egyes adatbázis-szekvenciák egysoros leírásai, amelyek megfelelnek a lekérdezési szekvenciának, ezek gyors áttekintést adnak a böngészéshez (3) az egyes egyeztetett adatbázis-szekvenciákhoz tartozó igazítások (egynél több igazítás is lehet egy adatbázis-szekvenciához, amelyhez illeszkedik) .
        A BLAST jelentés egysoros leírásaiban minden sor öt mezőből áll: (a) UniProtKB csatlakozási szám (b) UniProtKB azonosító, (c) a fehérje neve. Ez a sor gyakran le van vágva az egysoros leírásokban, hogy a kijelző tömör maradjon (d) az igazítási pontszám bitben. A magasabb pontozási találatok a lista elején találhatók, és (e) az E-érték, amely a statisztikai szignifikancia becslését adja. Az NCBI kézikönyvéből adaptálva.

        Az alábbiakban látható egy mintakimenet a BLAST kereséshez az UniRef100 adatbázis alapján

        1- Lekérdezés sorrendje bekapcsolva
        Kattintson erre a gombra a lekérdezéssorozat megjelenítéséhez. Ellenkező esetben kattintson újra az elrejtéséhez.

        2- Eredmények mentése más néven
        A keresési eredmények elmenthetők a felhasználó helyi számítógépére. Az eredmények mentésre kerülnek a kiválasztott bejegyzéseknél, vagy ha nincs fehérje kiválasztva, akkor az összes bejegyzésnél. A "Táblázat" gombra kattintva a megjelenített oszlopokat tabulátorral tagolt szövegfájlként menti, amelyet táblázatba importálhat a könnyebb megtekintés vagy elemzés érdekében. A "FASTA" gombra kattintva az azonosítók és sorozatok FASTA formátumban kerülnek mentésre.

        Oszlopok rendezése
        Az oszlopok az oszlop címe melletti nyílra kattintva a megfelelő értékek szerint rendezhetők. A táblázat alapértelmezés szerint Pontszám szerint van rendezve.

        A BLAST eredményeket minden klaszter reprezentatív tagjára számítjuk ki, a többi tagot (de nem a BLAST eredményeket) az "Összes tag megjelenítése" logóra kattintva láthatja. Az eredményeket egy táblázat tartalmazza a következő alapértelmezett oszlopokkal:

        UniRef100 azonosító
        A fürt azonosítójára utal. Ez alatt egy link található az UniRef100 jelentéshez, amely tartalmazza az UniRef100 fürt tagjainak adatait, valamint hivatkozások az UniRef50 és az UniRef90 fürtökhöz.

        Fehérje AC
        A Protein AC az UniProtKB csatlakozásra vagy UniParc azonosítóra utal. Ezen azonosítók alatt választhatja a fehérjejelentés iProClass vagy UniParc nézetét.

        Fehérje neve
        A fehérje általános neve, amely azonosítja a funkcióját vagy meghatározza annak jellemzőit.

        Hossz
        A peptidben vagy fehérjében található aminosavmaradékok száma.

        Szervezet neve
        A forrásszervezet nemzetsége és faja, amelyből a szekvencia származik. Hivatkozások találhatók az NCBI rendszertani információkra.

        BLAST szekvencia hasonlósági oszlopok
        Három oszlop kapcsolódik a BLAST eredményekhez. Az Alignment oszlop a jobb szélen a BLAST eredményeket mutatja grafikus formátumban. A felső sáv a lekérdezéssorozatot jelöli. Az alábbi sávok a lekérdezési szekvenciához illeszkedő egyéb szekvenciák régiójait mutatják. A sáv színe a BLAST pontszám nagyságát jelzi. Kattintson a sávok egyikére a BLAST -illesztés és a lekérdezési sorrend párosításához.

        SSearch Oszlopok
        Az SSearch a Smith-Waterman igazítási algoritmus páronkénti megvalósítása. Ha két sorozatot igazít, csak a megosztott régió jelenik meg. A megosztott régión belül az egyik vagy mindkét szekvencia aminosav -maradékai illeszthetők a másik szekvencia aminosavaihoz vagy réseihez. A megosztott régió teljes hossza a hézagokkal együtt az Átfedés oszlopban látható. Az azonos maradékok százalékos aránya az igazításban %identif. Erre a számra kattintva megjelenik az SSearch teljes hosszúságú igazítása.

        5- Az összes tag megjelenítése
        Erre a logóra kattintva megtekintheti az egyes klaszterekhez tartozó összes sorozatot.

        FASTA Keresés Súgó

        Mi az a FASTA?
        A FASTA használható szekvencia-adatbázisok keresésére, hasonlósági pontszámok értékelésére és periodikus struktúrák azonosítására a helyi szekvencia-hasonlóság alapján. A FASTA program össze tud hasonlítani egy fehérjeszekvenciát egy DNS-szekvencia-adatbázissal azáltal, hogy keresés közben lefordítja a DNS-adatbázist. Ez a keresőmotor FASTA eredményeket jelenít meg (legfeljebb 200 találat), a FASTA program (Pearson és Lipman, 1988) használatával, alapértelmezett beállításokkal.

        FASTA keresési formátum
        A FASTA „Keresés” beviteli területe elfogadja:

        FASTA opciók
        -Elvárás
        Az Elvárás (E-érték) küszöb statisztikai szignifikancia küszöbértéket határoz meg az adatbázis-szekvencia egyezések jelentéséhez. Az alapértelmezett érték 0.0001, ami azt jelenti, hogy várhatóan 0,0001 egyezést találunk csak véletlenül. Az alsó várakozási küszöbértékek szigorúbbak, ami kevesebb esélyes mérkőzés jelentését eredményezi. A várt küszöb növelése kevésbé szigorú egyezéseket mutat, és rövid sorozatokkal végzett kereséseknél javasolt, mivel egy rövid lekérdezés nagyobb valószínűséggel fordul elő véletlenül az adatbázisban, mint egy hosszabb, így még a tökéletes egyezés (nincs hiányosság) is alacsony statisztikai jelentőségű lehet. és nem jelenthetők be. A várható küszöb növelése lehetővé teszi, hogy lejjebb nézzen a találati listában, és megtekinthesse azokat az egyezéseket, amelyeket általában el kell vetni az alacsony statisztikai szignifikancia miatt.

          Pearson WR és DJ Lipman (1988) Javított eszközök a biológiai szekvencia -összehasonlításhoz. Proc. Natl. Acad. Sci. USA 85(8): 2444-2448.

        FASTA Results Help

        Az alábbiakban egy minta kimenet látható az UniProtKB adatbázisban végzett BLAST kereséshez

        1- Lekérdezés sorrendje bekapcsolva
        Kattintson erre a gombra a lekérdezéssorozat megjelenítéséhez. Ellenkező esetben kattintson újra az elrejtéséhez.

        2- Eredmények mentése más néven
        A keresési eredmények elmenthetők a felhasználó helyi számítógépére. Az eredmények mentésre kerülnek a kiválasztott bejegyzéseknél, vagy ha nincs fehérje kiválasztva, akkor az összes bejegyzésnél. A "Táblázat" gombra kattintva a megjelenített oszlopokat tabulátorral tagolt szövegfájlként menti, amelyet táblázatba importálhat a könnyebb megtekintés vagy elemzés érdekében. A "FASTA" gombra kattintva az azonosítók és sorozatok FASTA formátumban kerülnek mentésre.

        Oszlopok rendezése
        Az oszlopok az oszlop címe melletti nyílra kattintva a megfelelő értékek szerint rendezhetők. A táblázat alapértelmezés szerint Pontszám szerint van rendezve.

        A keresés eredményei egy táblázatban jelennek meg a következő alapértelmezett oszlopokkal:

        Fehérje AC/ID
        A fehérje AC/ID az UniProtKB csatlakozási számra és az azonosítóra vonatkozik. Ezen azonosítók alatt választhatja a fehérjejelentés iProClass vagy UniProtKB nézetét. Az UniProtKB szekvencia forrása UniProtKB/Swiss-Prot vagy UniProtKB/TrEMBL, ha a fehérjeszekvencia az UniProtKB Swiss-Prot vagy TrEMBL szakaszából származik.

        Fehérje neve
        A fehérje általános neve, amely azonosítja a funkcióját vagy meghatározza annak jellemzőit.

        Hossz
        A peptidben vagy fehérjében található aminosavmaradékok száma.

        Szervezet neve
        A forrásszervezet nemzetsége és faja, amelyből a szekvencia származik. Hivatkozások találhatók az NCBI rendszertani információkra.

        PIRSF azonosító
        Ha egy fehérje PIRSF családhoz tartozik, akkor ez az oszlop a megfelelő családazonosítót fogja megjeleníteni. Kattintson az azonosítóra a PIRSF jelentés letöltéséhez (lásd a megjegyzésekkel ellátott kimenetet).

        Sorozat hasonlósági oszlopok
        Három oszlop kapcsolódik a FASTA eredményekhez. Az Igazítás oszlop a jobb szélső oldalon grafikus formában mutatja a FASTA eredményeket. A felső sáv a lekérdezéssorozatot jelöli. Az alábbi sávok a lekérdezési szekvenciához illeszkedő egyéb szekvenciák régiójait mutatják. A sáv színe a FASTA pontszám nagyságát jelzi. Kattintson a sávok egyikére, ha meg szeretné tekinteni annak FASTA -igazítását a lekérdezéssorozattal párosítva.

        Kapcsolódó szekvencia súgó

        A kapcsolódó szekvenciák lekérése előre kiszámított BLAST eredmények alapján, így a lekérdezéséhez hasonló fehérjéket tekintheti meg, lényegesen gyorsabban, mint a BLAST futtatását. Ezt az eljárást körülbelül háromhavonta hajtják végre. Írja be az UniProtKB szekvencia azonosítót, és kattintson a "Keresés" gombra.

        1- E-érték kijelzése
        Az eredmények megjelenítéséhez válassza ki az E-érték határértéket.

        2- Lekérdezés sorrendje bekapcsolva
        Kattintson erre a gombra a lekérdezéssorozat megjelenítéséhez. Ellenkező esetben kattintson újra az elrejtéséhez.

        3- Eredmények mentése más néven
        A keresési eredmények elmenthetők a felhasználó helyi számítógépére. Az eredmények mentésre kerülnek a kiválasztott bejegyzéseknél, vagy ha nincs fehérje kiválasztva, akkor az összes bejegyzésnél. A "Táblázat" gombra kattintva a megjelenített oszlopokat tabulátorral tagolt szövegfájlként menti, amelyet táblázatba importálhat a könnyebb megtekintés vagy elemzés érdekében. A "FASTA" gombra kattintva az azonosítók és sorozatok FASTA formátumban kerülnek mentésre.

        Oszlopok rendezése
        Az oszlopok az oszlop címe melletti nyílra kattintva a megfelelő értékek szerint rendezhetők. A táblázat alapértelmezés szerint Pontszám szerint van rendezve.

        A keresés eredményei egy táblázatban jelennek meg a következő alapértelmezett oszlopokkal:

        Fehérje AC/ID
        A fehérje AC/ID az UniProtKB csatlakozási számra és az azonosítóra vonatkozik. Ezen azonosítók alatt választhatja a fehérjejelentés iProClass vagy UniProtKB nézetét. Az UniProtKB szekvencia forrása UniProtKB/Swiss-Prot vagy UniProtKB/TrEMBL, ha a fehérjeszekvencia az UniProtKB Swiss-Prot vagy TrEMBL szakaszából származik.

        Fehérje neve
        A fehérje általános neve, amely azonosítja a funkcióját vagy meghatározza annak jellemzőit.

        Hossz
        A peptidben vagy fehérjében található aminosavmaradékok száma.

        Szervezet neve
        A forrásszervezet nemzetsége és faja, amelyből a szekvencia származik. Hivatkozások találhatók az NCBI rendszertani információkra.

        PIRSF azonosító
        Ha egy fehérje PIRSF családhoz tartozik, akkor ez az oszlop a megfelelő családazonosítót fogja megjeleníteni. Kattintson az azonosítóra a PIRSF jelentés letöltéséhez (lásd a megjegyzésekkel ellátott kimenetet).

        Sorozat hasonlósági oszlopok
        Három oszlop kapcsolódik a BLAST eredményekhez. Az Alignment oszlop a jobb szélen a BLAST eredményeket mutatja grafikus formátumban. A felső sáv a lekérdezéssorozatot jelöli. Az alábbi sávok a lekérdezési szekvenciához illeszkedő egyéb szekvenciák régiójait mutatják. A sáv színe a BLAST pontszám nagyságát jelzi. Kattintson az egyik sávra, hogy megtekinthesse a lekérdezési sorrendhez párosított igazítását.

        Peptid Match


        Peptide mérkőzés eredményoldala

        1- A peptid lekérdezése
        Mutassa meg a lekérdezési peptidet, és engedélyezze a felhasználó számára, hogy új keresést végezzen egy új lekérdezési peptid elküldésével.

        2- Eredmények mentése más néven
        A kimenet a felhasználó helyi számítógépére menthető. Az eredmények mentésre kerülnek a kiválasztott bejegyzéseknél, vagy ha nincs fehérje kiválasztva, akkor az összes bejegyzésnél. A "Táblázat" gombra kattintva a megjelenített oszlopokat tabulátorral tagolt szövegfájlként menti, amelyet táblázatba importálhat a könnyebb megtekintés vagy elemzés érdekében. A "FASTA" gombra kattintva az azonosítók és sorozatok FASTA formátumban kerülnek mentésre.

        Fehérje AC/ID
        A Protein AC/ID az UniProtKB vagy UniRef100 azonosítókra utal. E számok alatt választhatja az egyes fehérjejelentések iProClass vagy UniProtKB/UniRef100 nézetét. Az UniProtKB szekvencia forrása UniProtKB/Swiss-Prot vagy UniProtKB/TrEMBL, ha a fehérjeszekvencia a Swiss-Protból vagy a TrEMBL-ből származik.

        Fehérje neve
        A fehérje általános neve, amely azonosítja a funkcióját vagy meghatározza annak jellemzőit.

        Hossz
        A peptidben vagy fehérjében található aminosavmaradékok száma.

        Szervezet neve
        A forrásszervezet nemzetsége és faja, amelyből a szekvencia származik. Hivatkozások találhatók az NCBI rendszertani információkra.

        PIRSF azonosító
        Ha egy fehérje PIRSF családhoz tartozik, akkor ez az oszlop a megfelelő családazonosítót fogja megjeleníteni. Kattintson az azonosítóra a PIRSF jelentés letöltéséhez (lásd a megjegyzésekkel ellátott kimenetet).

        Match Range
        Ez az oszlop pirossal mutatja a szekvencián belüli peptidlekérdezést.

        5- Több szervezet
        Kattintson ide az egyező élőlények rendszertani azonosítóinak megjelenítéséhez.

        6- Böngésszen taxonómiai csoportok szerint
        Kattintson az egyező szekvenciák taxonómiacsoportjainak megjelenítéséhez az alábbiak szerint.

        Minta keresés

        A minta egy képlet (reguláris kifejezés), amely a rokon fehérjék egy csoportjának konzervált régióját képviseli. A felépítés után a mintát egy mintaillesztő program használja fel, hogy megtalálja a konzervált régió lehetséges előfordulásait a szekvencia-adatbázisban.

        A PROSITE egy adatbázis, amely több mint ezer fehérjecsaládra vagy doménre jellemző mintákat és profilokat tartalmaz. Mindegyik aláíráshoz olyan dokumentáció tartozik, amely háttér-információkat nyújt ezen fehérjék szerkezetéről és működéséről.

        A fehérjék vagy fehérjecsoportok mintáinak azonosítása segíthet a fehérjék működésének értékelésében, vagy előre jelezhet egy bizonyos poszt-transzlációs módosítást. A minták keresésének eredményeit azonban tovább kell vizsgálni, mivel a megközelítés jellege miatt a minták gyakran túl specifikusak (sok hamis negatív) vagy nem eléggé szelektívek (nagy valószínűséggel fordulnak elő). Például a PROSITE minta esetében:
        PS00001
        Azonosító ASN_GLYCOSYLATION PATTERN.
        DE N-glikozilációs hely.
        PA N-

        -[UTCA]-


        Ez a minta megtalálható a legtöbb fehérjében, azonban az N-glikoziláció egy olyan módosítás, amely az endoplazmatikus retikulumban megy végbe a membrán és a kiválasztott fehérjék szintézise során.

          Használjon nagybetűket az aminosavmaradékokhoz, és tegyen egy "-" jelet két aminosav közé (nem kötelező).

        • A [ LIVM ] azt jelenti, hogy L, I, V vagy M lehet az első helyen.
        • azt jelenti, hogy C és F ne legyen abban a bizonyos helyzetben
        • x (3) ugyanaz, mint "xxx"
        • "x (1,4) jelentése "x" vagy "xx" vagy "xxx" vagy "xxxx"
        • A "& gtMDEL" csak MDEL karakterrel kezdődő sorozatokat talál
        • A "DEL & gt" csak DEL -vel végződő sorozatokat talál

        Megjegyzés: A fenti mintát a következőképpen is megírhatja:
        [LIVM] [VIC] x (2) G [DENQTA] x [GAC] x (2) [LIVMFY] (4) x (2) G

        Eredmény a PS00888 PROSITE mintájú fehérjékre (ciklikus nukleotid-kötő domén aláírása 1)

        1- Eredmények mentése másként
        A kimenet a felhasználó helyi számítógépére menthető. Az eredmények mentésre kerülnek a kiválasztott bejegyzéseknél, vagy ha nincs fehérje kiválasztva, akkor az összes bejegyzésnél. A "Táblázat" gombra kattintva a megjelenített oszlopokat tabulátorral tagolt szövegfájlként menti, amelyet táblázatba importálhat a könnyebb megtekintés vagy elemzés érdekében. A "FASTA" gombra kattintva az azonosítók és sorozatok FASTA formátumban kerülnek mentésre.

        3- Eredmények megjelenítése
        A keresés eredményei táblázatban jelennek meg. Az oszlopok az oszlop címe melletti nyílra kattintva a megfelelő értékek szerint rendezhetők.

        Fehérje AC/ID
        A fehérje AC/ID az UniProtKB csatlakozásra és azonosítóra vonatkozik. Ezek alatt az egyes fehérjejelentések iProClass vagy UniProtKB nézetét választhatja ki. Az UniProtKB szekvencia forrása UniProtKB/Swiss-Prot vagy UniProtKB/TrEMBL, ha a fehérjeszekvencia a Swiss-Protból vagy a TrEMBL-ből származik.

        Fehérje neve
        A fehérje általános neve, amely azonosítja a funkcióját vagy meghatározza annak jellemzőit.

        Hossz
        A peptidben vagy fehérjében található aminosavmaradékok száma.

        Szervezet neve
        A forrásszervezet nemzetsége és faja, amelyből a szekvencia származik. Hivatkozások találhatók az NCBI rendszertani információkra.

        PIRSF azonosító
        Ha egy fehérje PIRSF családhoz tartozik, akkor ez az oszlop a megfelelő családazonosítót fogja megjeleníteni. Kattintson az azonosítóra a PIRSF jelentés letöltéséhez (lásd a megjegyzésekkel ellátott kimenetet).

        Match Range
        Ez az oszlop a lekérdezési minta sorozattartományát jeleníti meg.

        Részleges eredmény a PROSITE mintákhoz az UniProtKB O05689 -ben

        Többszörös igazítás súgó

        Válassza ki az igazítási programot: ClustalW, T-Cofee vagy Muscle. Ezután írjon be több (legfeljebb 70) szekvenciát a hozzájuk tartozó azonosító sorokkal FASTA formátumban, vagy írjon be több UniProtKB azonosítót sorokkal, vesszővel vagy szóközökkel elválasztva. Ezután kattintson a "Küldés" gombra.
        Az eredményoldalon megjelenik az igazítás és igazítás megjelenítő. A ClustalW és a T-Coffee esetében a szomszédhoz csatlakozó fa és az igazítás megtekinthető, szerkeszthető és menthető a PIR-TAV néző vagy a JalView használatával (lásd alább). Csak Muscle számára elérhető a Jalview.

        FASTA formátum
        A FASTA formátumú sorozat egysoros leírással kezdődik, amelyet a szekvenciaadatok sora követ. A leírási sort az első oszlopban lévő (>>) szimbólum különbözteti meg a szekvenciaadattól. A FASTA formátum használatának egyik előnye, hogy a szekvenciaazonosítót az eredményekkel együtt jelentik. Egy példa sorozat FASTA formátumban:

        > Gi | 3287971 | sp | P37025 | LIGT_ECOLI 2'-5' RNS ligázt MSEPQRLFFAIDLPAEIREQIIHWRATHFPPEAGRPVAADNLHLTLAFLGEVSAEK EKALSLLAGRIRQPGFTLTLDDAGQWLRSRVVWLGMRQPPRGLIQLANMLRSQA ARSGCFQSNRPFHPHITLLRDASEAVTIPPPGFNWSYAVTEFTLYASSFARGRTRY TPLKRWALTQ

        Súgó párosításhoz

        Szúrjon be két szekvenciát az egybetűs aminosavkód használatával, vagy írjon be két UniProtKB azonosító kódot. Nyomja meg a "Küldés" gombot, és az igazítási eredmények megjelenítik az SSEARCH Smith-Waterman teljes hosszúságú illesztéseket két sorozat között (SSEARCH program 3.4t24, 2004. július 21.).

        P53039 és Q6FQ69 páros igazítása

        Súgó az ID -leképezéshez

        Ez a funkció lehetővé teszi az azonosítók leképezését az UniProtKB és más adatbázisok között

        Először adja meg a forrásadatok azonosítójának típusát (többféle azonosítót választhat ki a ctrl billentyűvel). Adja meg a leképezéshez használni kívánt azonosító típusát. Gépelje be vagy illessze be az azonosítókat a mezőbe szóközzel vagy visszatérési gombbal elválasztva. Alternatív megoldásként feltölthet egy fájlt az azonosítók listájával. Válassza ki a kimeneti formátumot, és végül nyomja meg a "Térkép" gombot.

        Az eredményoldal az azonosító egyezések listáját tartalmazza. Az azonosítók szükség esetén kivághatók és beilleszthetők, vagy szöveges fájlként menthetők a webböngészője által biztosított "mentés másként" opció segítségével.
        Lásd a megjegyzésekkel ellátott kimenetet alább.

        A GI számok leképezése UniProt AC -khez

        Összetétel/molekulatömeg-számítás súgó

        Egy vagy több szekvencia összetételinformációinak és molekulatömegének lekérése az UniProtKB azonosító vagy az egybetűs aminosavkód alapján. Az eredmények a szekvenciában lévő egyes aminosavak aminosavainak számát és százalékos arányát tartalmazzák. Az egyes aminosavak molekulatömegére és molekulatömegére vonatkozó számítási megjegyzések is megadásra kerülnek.

        Molekulatömeg -összetétel a P53039 számára

        PIRSF szkennelés

        Keresse meg a lekérdezési sorrendet a teljesen válogatott PIRSF családok között. Amikor elküldi a lekérdezési sorozatot, a rendszer megkeresi a teljes hosszúságú és tartományi HMM-modellek alapján a HMMER program által teljesen válogatott PIRSF-eket. Ha talál egyezést, az egyező régiók és statisztikák jelennek meg. A lekérdezési sorrendet egybetűs kóddal vagy UniProtKB azonosítóval kell megadni.

        Aminosav szekvencia kód táblázat

        UniProtKB azonosítók a BLAST/FASTA kereső- és elemzőeszközökhöz

        A következő táblázat példákat mutat be az UniProtKB csatlakozási számra és azonosítóra

        PIRSF jelentés PIRSF000186 jelentésminta. A számozott mezőkkel kapcsolatos információk az alábbiakban találhatók. 1- PIRSF Hierarchia DAG nézet 2- PIRSF rendszertani eloszlás 3- Többszörös igazítás 4- Domain architektúra

        Master Protein Directory Súgó

        Ez a rész a Master Protein Directory Text Search oldalt írja le. A Master Directory információkat tartalmaz a NIAID Biodefense Proteomics Research Centerei által azonosított fehérjékről és reagensekről. Az oldal általános elrendezése hasonló a normál PIR szöveges keresési eredményekhez, azonban eltér a megjelenített alapértelmezett oszlopokban, és további keresési attribútumokkal rendelkezik. Két oszlopos kijelző létezik: 1) alapértelmezett kijelző, amely több adattípus együttes megjelenítésére szolgál (pl. MS_proteomic és Microarray), és 2) adattípus-specifikus, amely akkor használatos, ha csak egy adattípus van kiválasztva, és az adott adatokra vonatkozó további információkat tartalmaz. csak típus. Az adatspecifikus megjelenítés megtekintéséhez a legördülő menüből -- Válassza ki a megjelenítendő adattípust -- válasszon adattípust.

        Több adattípus alapértelmezett megjelenítése

        Adattípus -specifikus kijelző (Microarray)

        Keresési és találati lehetőségek

        1- Válogatás böngészése
        Alapértelmezés szerint a könyvtár minden adatot megjelenít. Ez a funkció, az oldal tetején található lehetőségek legördülő menüje, lehetővé teszi a böngészés korlátozását 1) adattípus, 2) Proteomikai Kutatóközpont és 3) Szervezet

        2- Keresés
        Lehetővé teszi további keresések végrehajtását abban az esetben, ha tovább szeretné szűrni a kimenetet, vagy új keresést szeretne elindítani (nem kell visszatérnie az előző oldalra). A rendelkezésre álló opciók egy legördülő menüben jelennek meg, és ugyanazok a fehérje attribútumok, mint az iProClass adatbázisban találhatók, hozzáadva a Master Directory fejléc alatt felsorolt ​​könyvtárspecifikus attribútumokat. Írjon be bármilyen szöveges karakterláncot vagy alstringet, a kis- és nagybetűk nem számítanak. Ha csak egy érték jelenlétét vagy hiányát szeretné meghatározni, használja a „nem null” vagy „null” szavakat. A helyettesítő karakterek használata megengedett.

        3- Megjelenítési lehetőségek
        Az egyedi igényektől függően kiválaszthatja a megjelenítendő oszlopokat. Ehhez kattintson a "Megjelenítési opció" gombra, válassza ki a megfelelő mező (ke) t a "Mezők nem jelennek meg" listában, és a ">" gombbal vigye át a "Megjelenített mezők" listába. Ezzel szemben az oszlopok eltávolíthatók a kijelzőről. Végül kattintson az "Alkalmaz" gombra, hogy a módosítások életbe lépjenek.

        4- Eredmények mentése más néven
        A kimenet a felhasználó helyi számítógépére menthető. Az eredmények mentésre kerülnek a kiválasztott bejegyzéseknél, vagy ha nincs fehérje kiválasztva, akkor az összes bejegyzésnél. A "Táblázat" gombra kattintva a megjelenített oszlopokat tabulátorral tagolt szövegfájlként menti, amelyet táblázatba importálhat a könnyebb megtekintés vagy elemzés érdekében. A "FASTA" gombra kattintva az azonosítók és sorozatok FASTA formátumban kerülnek mentésre.


        Adattípus -specifikus kijelző (Microarray)

        6- Eredmények megjelenítése
        A keresés eredményei egy testreszabható táblázatban jelennek meg. A megjelenített pontos oszlopok a keresett mezőktől és a felhasználói preferenciáktól függenek.

        Fehérje AC/ID
        A fehérje AC/ID az UniProtKB vagy UniParc azonosítókra utal. E számok alatt választhatja a fehérjejelentés iProClass vagy UniProtKB/UniParc nézetét. Az UniProtKB szekvencia forrása UniProtKB/Swiss-Prot vagy UniProtKB/TrEMBL néven jelenik meg, ha a fehérjeszekvencia az UniProt tudásbázis Swiss-Prot vagy TrEMBL szakaszából származik. Alternatív megoldásként az UniParc azonosító jelenik meg, ha a sorozat nem szerepel az UniProtKB adatbázisban, de jelen van az UniParcban.

        Dir.ID
        A Directory ID egy egyedi azonosító, amelyet a Proteomic Research Center által benyújtott adatokból választanak ki. A főkönyvtárban egy adott kutatási eredmény azonosítására és a mesterkönyvtárban található fehérjeinformációk összekapcsolására a Fehérjebank részletes eredményeivel használják.

        Központ
        Azonosítja az adatokat előállító NIAID Biodefense Proteomikai Kutatóközpontot. A névre kattintva további információk jelennek meg a központról és az általuk benyújtott adatokról.

        Adattípus
        Azonosítja a megadott adatok típusát. Az Adattípus nevére kattintva egy új ablak nyílik meg a fehérjeinformációkkal az adattípus-specifikus formátumban.

        számú kísérlet
        Linkek a kapcsolódó kísérleti adatokhoz a fehérjeadatbankban.

        Fehérje neve
        A fehérje általános neve, amely azonosítja a funkcióját vagy meghatározza annak jellemzőit.

        Hossz
        A peptidben vagy fehérjében található aminosavmaradékok száma.

        Szervezet neve
        A forrásszervezet nemzetsége és faja, amelyből a szekvencia származik. Hivatkozások találhatók az NCBI rendszertani információkra.

        PIRSF azonosító
        Ha egy fehérje PIRSF családhoz tartozik, akkor ez az oszlop a megfelelő családazonosítót fogja megjeleníteni. Kattintson az azonosítóra a PIRSF jelentés letöltéséhez (lásd a megjegyzésekkel ellátott kimenetet).

        7 Adattípus-specifikus keresési beállítások
        A fent felsorolt ​​összes gyakori mezőben lehet keresni, csakúgy, mint a felhasználó által hozzáadott opcionális oszlopokban. Ezen kívül vannak adattípus -specifikus mezők, amelyek csak az adattípus -specifikus kijelzőn jelennek meg, de kereshetők is. Megjegyzés: egyes reagens -specifikus mezők üresek lehetnek.

        Teljes előrejelzett proteómák súgó

        Ez az eszköz lehetővé teszi a szöveges kereséseket, amelyek teljes proteómákra korlátozódnak, amint azt az UniProt Konzorcium megjegyzi, és a Biodefense Proteomics Research Program tanulmányozza. Az eredmények a Master Protein Directory -hoz kapcsolódnak, amely kísérleti információkat tartalmaz egyes fehérjékről.

        Kezdésként válassza ki a kívánt proteómákat és keresse meg.

        Keresési és találati lehetőségek

        1- Keresés
        Az eszközben tovább szűkítheti a keresést. Az elérhető opciók egy legördülő menüben jelennek meg, és ugyanazok a fehérje attribútumok, mint az iProClass adatbázisban találhatók, a - Master Directory (MD) opció hozzáadásával. Írjon be bármilyen szöveges karakterláncot vagy alstringet, a kis- és nagybetűk nem számítanak.Ha csak egy érték jelenlétét (+) vagy hiányát (üres) szeretné meghatározni, használja a „not null” vagy a „null” szavakat. A helyettesítő karakterek használata megengedett.

        2- Kijelző opciók
        Az egyedi igényektől függően kiválaszthatja a megjelenítendő oszlopokat. Ehhez kattintson a "Megjelenítési opció" gombra, válassza ki a megfelelő mező (ke) t a "Mezők nem jelennek meg" listában, és a ">" gombbal vigye át a "Megjelenített mezők" listába. Ezzel szemben az oszlopok eltávolíthatók a kijelzőről. Végül kattintson az "Alkalmaz" gombra, hogy a módosítások életbe lépjenek.

        3- Eredmények mentése más néven
        A kimenet a felhasználó helyi számítógépére menthető. Az eredmények mentésre kerülnek a kiválasztott bejegyzéseknél, vagy ha nincs fehérje kiválasztva, akkor az összes bejegyzésnél. A "Táblázat" gombra kattintva a megjelenített oszlopokat tabulátorral tagolt szövegfájlként menti, amelyet táblázatba importálhat a könnyebb megtekintés vagy elemzés érdekében. A "FASTA" gombra kattintva az azonosítók és sorozatok FASTA formátumban kerülnek mentésre.

        5- Eredmények megjelenítése
        A keresés eredményei egy testreszabható táblázatban jelennek meg. A megjelenített pontos oszlopok a keresett mezőktől és a felhasználói preferenciáktól függenek.

        Fehérje AC/ID
        A fehérje AC/ID az UniProtKB vagy UniParc azonosítókra utal. E számok alatt választhatja a fehérjejelentés iProClass vagy UniProtKB/UniParc nézetét. Az UniProtKB szekvencia forrása UniProtKB/Swiss-Prot vagy UniProtKB/TrEMBL néven jelenik meg, ha a fehérje szekvencia a Swiss-Prot vagy a TrEMBL szakaszból származik. Alternatív megoldásként az UniParc azonosító jelenik meg, ha a sorozat nincs jelen az UniProtKB adatbázisban az UniParc jelentéssel együtt.

        MD (főkönyvtár)
        A Biodefense Proteomics Research Program főkönyvtárában információval rendelkező fehérjéket (+) jelzi az MD oszlopban. Ha csak az MD -ben található fehérjékre szeretné korlátozni a keresést, válassza a „Master Directory” lehetőséget a keresési mezőbe, és adja meg az „igen” vagy „nem null” értéket.

        Fehérje neve
        A fehérje általános neve, amely azonosítja a funkcióját vagy meghatározza annak jellemzőit.

        Hossz
        A peptidben vagy fehérjében található aminosavmaradékok száma.

        Szervezet neve
        A forrásszervezet nemzetsége és faja, amelyből a szekvencia származik. Hivatkozások találhatók az NCBI rendszertani információkra.

        PIRSF azonosító
        Ha egy fehérje PIRSF családhoz tartozik, akkor ez az oszlop a megfelelő családazonosítót fogja megjeleníteni. Kattintson az azonosítóra a PIRSF jelentés letöltéséhez (lásd a megjegyzésekkel ellátott kimenetet).

        Kapcsolódó sz.
        Ez az oszlop az alapértelmezett paraméterekkel kapott előre kiszámított BLAST-találatok számát mutatja. Csak legfeljebb 300 sorozat jelenik meg. A számra kattintva elérheti a kapcsolódó sorozatlapot. Ez lehetővé teszi a sorozatok hasonlóságának nagyon gyors pillantását. Maga a szám már ad némi információt arról, hogy mennyire egyedi a fehérje. Például egy nagyon alacsony szám azt jelezheti, hogy a lekérdezés egy bizonyos fajra, nemzetségre, taxonra stb. Vonatkozik. A Kapcsolódó sorozat címe melletti " +" jel lehetővé teszi a kapcsolódó szekvenciák számának összehasonlítását 3 különböző E-értéknél határértékek az alábbiak szerint.

        GO Slim elemzés

        A GO karcsúságok a Gene Ontologies kisebb változatai, amelyek a GO egészében található kifejezések egy részhalmazát tartalmazzák. Széles körű áttekintést adnak az ontológia tartalmáról, a konkrét finom szempontok részletezése nélkül. A GO karcsúságok különösen hasznosak egy genom vagy proteóm GO annotációjának eredményeinek összefoglalásához, ha a géntermék funkcióinak széles körű osztályozása szükséges.

        Megtekintheti a GO slim feltételeket a biológiai funkciókra, összetevőkre és folyamatokra az elemző eszköztár „Show GO Slim” gombjának kiválasztásával. Ezután megtekintheti az egyes ontológiák (függvény, komponens és függvény) statisztikáit, ha megnézi az érdeklődésre számot tartó bejegyzéseket, és kiválasztja a megjeleníteni kívánt ontológiát. Kövesse a GO ID hivatkozásokat, ha többet szeretne megtudni a GO kifejezésről.

        A Master Reagent Directory súgója

        Ez a szakasz a Master Reagent Directory szövegkeresési oldalát írja le. A Reagens Directory tartalmazza a NIAID Biodefense Proteomics Research Centre által azonosított reagenseket, és linkeket biztosít a tárolókhoz, ahol reagenseket lehetett beszerezni. Az oldal általános elrendezése hasonló a normál PIR szöveges keresési eredményekhez, azonban eltér a megjelenített alapértelmezett oszlopokban, és további keresési attribútumokkal rendelkezik. Ez a két oszlopos kijelző: 1) alapértelmezett kijelző, amely több reagenstípus együttes megjelenítésére szolgál (pl. antitestek és klónok), és 2) reagenstípus-specifikus, amely akkor használatos, ha csak egy reagenstípus van kiválasztva, és az adott reagensre vonatkozó további információkat tartalmaz. csak.

        Több reagens típus alapértelmezett megjelenítése

        Reagens típus specifikus kijelző (antitest)

        Keresési és találati lehetőségek

        1- Válogatás böngészése
        Alapértelmezés szerint a könyvtár az összes reagenst mutatja. Ez a funkció, a lehetőségek legördülő menüje, lehetővé teszi a böngészés korlátozását 1) reagens típus, 2) Proteomics Research Center és 3) Organism

        2- Keresés
        Lehetővé teszi további keresések végrehajtását abban az esetben, ha tovább szeretné szűrni a kimenetet, vagy új keresést szeretne elindítani (nem kell visszatérnie az előző oldalra). A rendelkezésre álló lehetőségek egy legördülő menüben láthatók (lásd alább az aktuális lehetőségeket). Írjon be bármilyen szöveges karakterláncot vagy alstringet, a kis- és nagybetűk nem számítanak. Ha csak egy érték jelenlétét vagy hiányát szeretné meghatározni, használja a „nem null” vagy „null” szavakat.

        3- Megjelenítési lehetőségek
        Az egyedi igényektől függően kiválaszthatja a megjelenítendő oszlopokat. Ehhez kattintson a "Megjelenítési opció" gombra, válassza ki a megfelelő mező (ke) t a "Mezők nem jelennek meg" listában, és a ">" gombbal vigye át a "Megjelenített mezők" listába. Ezzel szemben az oszlopok eltávolíthatók a kijelzőről. Végül kattintson az "Alkalmaz" gombra, hogy a módosítások életbe lépjenek.

        4- Eredmények mentése más néven
        A kimenet a felhasználó helyi számítógépére menthető. Az eredmények mentésre kerülnek a kiválasztott bejegyzésekhez, vagy ha nincsenek kiválasztva reagensek, akkor az összes bejegyzéshez. A "Táblázat" gombra kattintva a megjelenített oszlopokat tabulátorral tagolt szövegfájlként menti, amelyet táblázatba importálhat a könnyebb megtekintés vagy elemzés érdekében.

        5- Eredmények megjelenítése
        A keresés eredményei egy testreszabható táblázatban jelennek meg. A megjelenített pontos oszlopok a keresett mezőktől és a felhasználói preferenciáktól függenek. Az alapértelmezett oszlopokat az alábbiakban ismertetjük.

        Reagensazonosító
        A Reagens ID hivatkozás egyedi azonosító. Ha a reagens a BEI erőforrásba kerül, ugyanaz az azonosító, amelyet a BEI -nél használt.

        Reagens típusa
        Azonosítja a reagens típusát. A reagenstípus nevére kattintva egy új ablak nyílik meg a reagensinformációkkal a reagensspecifikus formátumban.

        Név/Leírás
        Leíró szöveg a reagensről.

        Szervezet neve
        Annak a forrásszervezetnek a nemzetsége és faja, amelyből a reagens kifejlesztésre került vagy amelyre kifejlesztették. Például: A bakteriális törzsek itt a baktériumfajok nevét tüntetik fel, nem pedig a törzset. Az egérből vagy nyúlból származó antitestek az antigén organizmusokat sorolják fel. Hivatkozások találhatók az NCBI rendszertani információkra.

        Központ
        Azonosítja a reagenst előállító NIAID Biodefense Proteomics Research Center -t. A névre kattintva további információk jelennek meg a központról és az általuk benyújtott adatokról.

        számú kísérlet
        Linkek a kapcsolódó kísérleti adatokhoz a fehérjeadatbankban. Ha ezeket a reagenseket egy adott kísérletsorozathoz használták, ez a szám összekapcsolódik az adatokkal.

        Kiadvány
        Hivatkozások a reagenseket használó KNK -kiadványokra.

        Forrás
        Hivatkozások a reagens -tárolókra, ahol a felhasználók beszerezhetik a reagenst.

        6- Reagens specifikus keresési lehetőségek
        A fent felsorolt ​​összes gyakori mező kereshető. Ezen kívül vannak reagens -specifikus mezők, amelyek csak a reagens -specifikus kijelzőn jelennek meg, de kereshetők is. Megjegyzés: egyes reagens -specifikus mezők üresek lehetnek.

        Referencia Proteomes Help

        1. Mik azok a referenciaproteómák?
        A referenciaproteomok (RP-k) olyan proteomok, amelyeket a reprezentatív proteomcsoportokból (RPG-k) választanak ki, amelyek hasonló proteomokat tartalmaznak az UniRef50 klaszterekben való társtagság alapján. A referenciaproteom az a proteom, amely a legjobban képes reprezentálni a csoportjába tartozó összes proteomot a szekvenciatér és az információk többsége szempontjából. A 75% -os, 55% -os, 35% -os és 15% -os társ-tagsági küszöbértékeket tartalmazó RP-k lehetővé teszik a felhasználók számára, hogy igényeik alapján csökkentsék vagy növeljék a szekvenciatér részletességét.

        2. Referencia Proteomes BLAST keresés.
        1. Válasszon egy adatbázist A BLAST keresés végrehajtható RP75, RP55, RP35 vagy RP15 ellen: Az alacsonyabb RP -k (például RP15) kevesebb proteómával rendelkeznek, mint a magasabb RP -k (például RP75). Például a legkevesebb BLAST eredmény eléréséhez válassza az RP15 lehetőséget. A BLAST -tal kapcsolatos további segítségért keresse fel a https://proteininformationresource.org/pirwww/support/help.shtml#3 címet.

        3. Az RP elérhetősége és használata.
        A 75, 55, 35 és 15 (RP75, RP55, RP35 és RP15) küszöbértékekhez a megfelelő reprezentatív Proteome Group fájlok állnak rendelkezésre az RP kezdőlapján található linkeken keresztül, az alábbi formátumban: fájlokat FASTA formátumban az RP75, RP55, RP35 és RP15 készletekhez. A felhasználók dönthetnek úgy, hogy saját testreszabott RP-készletet készítenek az RP kezdőlapján található hivatkozáson keresztül elérhető taxon-alapú táblázat vagy perl-szkript segítségével. Például azt gyanítjuk, hogy egyes felhasználók számára az ideális készlet az RP75 állatokhoz + RP55 más sejtes organizmusokhoz + minden hiányzó GO referenciagenom.

        4. Referencia Proteome elérhetőség az iProClass felületről.
        Az iProClass egy integrált adattárház, amely tartalmazza az összes UniProtKB fehérjét és az NCBI erőforrásokból származó további fehérjéket. A meghatározott reprezentatív proteomkészletekből származó fehérjék az iProClass-ban vannak indexelve, és elérhetők a BLAST számára (http://proteininformationresource.org/rps/blast_rp.shtml). Ezenkívül az RP55 készlet összes fehérje lekérhető a http://proteininformationresource.org/pirwww/search/textsearch.shtml webhelyről, ha kiválasztja a Rep Proteome elemet, majd beírja, hogy nem null, és rákattint a Keresés gombra. A felhasználók további szűrést végezhetnek a beolvasott halmazon, ha logikai kereséseket hajtanak végre a szövegkeresés legördülő menüből elérhető több mint 65 mező használatával. A BLAST és a szöveges keresési eredmények letölthetők a találati oldalról további elemzés céljából.

        5. A referenciaproteomák böngészése.
        A négy különböző küszöbértékhez tartozó RP-k a http://proteininformationresource.org/cgi-bin/rps_tree.pl oldalon tekinthetők meg. A legtöbb csomópont az Archaea, a Baktériumok és az Eukaryota, a teljesen kibontott nézet pedig az összes proteómát mutatja, amelyeket az RP -k azonosítására elemeztek. Ha az RP -ket különböző küszöbértékeken böngészi a különböző rendszertani csomópontokhoz, akkor nyomokat találhat arra vonatkozóan, hogy melyik CMT a legjobb egy adott ághoz, és hogyan oszlanak el az RP -k a rendszertani fában. Miután a kívánt RP-készlet megjelenik a képernyőn, kinyomtatható későbbi hivatkozás céljából.

        6. Referencia Proteomes adatfrissítés.
        A szövegkereséshez és a BLAST -kereséshez használt fehérjekészletek négyhetente frissülnek. Félévente új proteómákat adnak hozzá. Minden kiadást legalább 5 évig archiválnak.


        Szerzői információk

        Tartozások

        Biológiai Tudományok Osztálya, Pacific Northwest National Laboratory, Richland, WA, 99352, USA

        Szereplők: Charles Ansong, Samuel H Payne, Jessica L Martin, Meagan C Burnet, Matthew E Monroe, Richard D Smith és Joshua N Adkins

        Environmental Molecular Sciences Laboratory, Pacific Northwest National Laboratory, Richland, WA, 99352, USA

        Nikola Tolić és Samuel O Purvine

        Vaccine Research Institute of San Diego, San Diego, CA, 92121, USA

        Steffen Porwollik és Michael McClelland

        Pathogen Functional Genomics Resource Center, J. Craig Venter Institute, Rockville, MD, 20850, USA

        Marcus Jones, Pratap Venepally és Scott N Peterson

        Molekuláris Mikrobiológiai és Immunológiai Tanszék, Oregon Egészségügyi és Tudományi Egyetem, Portland, OR, 97239, USA